DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22b and Or65b

DIOPT Version :9

Sequence 1:NP_477425.1 Gene:Or22b / 33336 FlyBaseID:FBgn0026397 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster


Alignment Length:285 Identity:56/285 - (19%)
Similarity:111/285 - (38%) Gaps:62/285 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 FCYIFYHIAYTSFLISNFLSFIMKR---IH----AWRMYFPYVDPEKQFYISSIAEVIL--RGWA 197
            |...|:.....||.:...|..::..   :|    .:...||:...||..:..|.|.:.|  ..:|
  Fly   143 FVMAFFLATSWSFFLCILLLLLITSPMWVHQQNLPFHAAFPFQWHEKSLHPISHAIIYLFQSYFA 207

  Fly   198 VF---MDLCTD---VCPLISMVIARCHITLLKQR--------LRNLRSEPGRTEDEYLKELADCV 248
            |:   ..||.:   :| :.:.:.....:..|:.|        |:.||.|..|           .|
  Fly   208 VYCLTWLLCIEGLSIC-IYAEITFGIEVLCLELRQIHRHNYGLQELRMETNR-----------LV 260

  Fly   249 RDHRLILDYVDALRSVFSGTIFVQFLLIGIVLGLSMINIMFFSTLST----------GVAVVLFM 303
            :.|:.|::.:|....||.||:.:|   :|:  ..|::::.....:..          .|.::|.:
  Fly   261 KLHQKIVEILDRTNDVFHGTLIMQ---MGV--NFSLVSLSVLEAVEARKDPKVVAQFAVLMLLAL 320

  Fly   304 SCVSMQTFPFCYLCNMIMDDCQEMADSLFQS-DWTSADRRYKSTLVYFLHNLQQPIILTAGGVFP 367
            ..:||    :.|..:.:.....:::::.::: |.|...:.....|...:...|.|:|:.| ..||
  Fly   321 GHLSM----WSYCGDQLSQKSLQISEAAYEAYDPTKGSKDVYRDLCVIIRRGQDPLIMRA-SPFP 380

  Fly   368 ----ISMQTNLNMVK--LAFTVVTI 386
                |:....||...  |.|.:.|:
  Fly   381 SFNLINYSAILNQCYGILTFLLKTL 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22bNP_477425.1 7tm_6 81..381 CDD:251636 54/278 (19%)
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 53/273 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465237
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.