DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22b and Or65a

DIOPT Version :9

Sequence 1:NP_477425.1 Gene:Or22b / 33336 FlyBaseID:FBgn0026397 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_729161.1 Gene:Or65a / 318011 FlyBaseID:FBgn0041625 Length:417 Species:Drosophila melanogaster


Alignment Length:426 Identity:78/426 - (18%)
Similarity:162/426 - (38%) Gaps:99/426 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RVKSRDAFVYLDR-VMWSFGWTVPENKRWDLHYKLWSTFVTL----------------------- 57
            :.|||....|..| .:.:.|:.:...:|.......|..||::                       
  Fly    31 QAKSRHIIAYWTRDQLKALGFYMNSEQRRLPRIVAWQYFVSIQLATALASLFYGISESIGDIVNL 95

  Fly    58 ---LIFILLPISVSVEYIQRFKTFSAGEFLSSIQIGVNMYGSSFKSYLTMMGYKKRQEAKMSLDE 119
               |:||:..|.:....:  |....|||....|....::|..|.|...|    |:.||.|     
  Fly    96 GRDLVFIITIIFICFRLV--FFAQYAGELDVIIDALEDIYHWSIKGPAT----KEVQETK----- 149

  Fly   120 LDKRCVCDEERTIVHRHVALGNFCYIFYHIAYTSFLISNFL------SFIMKRIHAWRMYFPYV- 177
                          ..|..|    ::...|.:.||||...|      .:|..:...:.:.:|:. 
  Fly   150 --------------RLHFLL----FMALIITWFSFLILFMLIKISTPFWIESQTLPFHVSWPFQL 196

  Fly   178 -DPEKQ----------------FYISSIAEVILRGWAVFMDLCTDVCPLISMVIARCHITLLKQR 225
             ||.|.                :::..:..|...|.::|.:|.:             .:.:|...
  Fly   197 HDPSKHPIAYIIIFVSQSTTMLYFLIWLGVVENMGVSLFFELTS-------------ALRVLCIE 248

  Fly   226 LRNLRSEPGRTEDEYLKELADCVRDHRLILDYVDALRSVFSGTIFVQFLLIGIVLGLSMINIMFF 290
            ||||:......||...:||....:.|:.|:...|....:|:|...:|.|:..:::.||:..:: .
  Fly   249 LRNLQELCLGDEDMLYRELCRMTKFHQQIILLTDRCNHIFNGAFIMQMLINFLLVSLSLFEVL-A 312

  Fly   291 STLSTGVAV---VLFMSCVSMQTFPFCYLCNMIMDDCQEMADSLFQS-DWTSADRRYKSTLVYFL 351
            :..:..|||   ::.:..:...:| :....:|...:.:::|.::::: |.....:.......:|:
  Fly   313 AKKNPQVAVEYMIIMLMTLGHLSF-WSKFGDMFSKESEQVALAVYEAYDPNVGSKSIHRQFCFFI 376

  Fly   352 HNLQQPIILTAGGVFPISMQTNLNMVKLAFTVVTIV 387
            ...|:|:|:.|....|.:::..:.::|..::::||:
  Fly   377 QRAQKPLIMKASPFPPFNLENYMFILKQCYSILTIL 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22bNP_477425.1 7tm_6 81..381 CDD:251636 60/327 (18%)
Or65aNP_729161.1 7tm_6 145..406 CDD:251636 52/298 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465255
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.