DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22b and Or2a

DIOPT Version :9

Sequence 1:NP_477425.1 Gene:Or22b / 33336 FlyBaseID:FBgn0026397 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster


Alignment Length:405 Identity:86/405 - (21%)
Similarity:173/405 - (42%) Gaps:41/405 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EKPLSERVKSRDAFVYLDRVMWSFGWTVPENKRWDLHYKLWSTFVTLLIFILLPISVSVEYIQRF 75
            ||....::.:..|..|..||....|...|.... .|.|.::|..|.|::.:|.|:|:....:  |
  Fly     2 EKQEDFKLNTHSAVYYHWRVWELTGLMRPPGVS-SLLYVVYSITVNLVVTVLFPLSLLARLL--F 63

  Fly    76 KTFSAGEFLSSIQIGVNMYGSSFKSYLTMMGYKKRQEAKMSLDELDKRC--VCDEERTIVHR--- 135
            .|..|| ...::.|.:....::.|.....|..|:..|.:..|..:|.|.  |.|.|.....|   
  Fly    64 TTNMAG-LCENLTITITDIVANLKFANVYMVRKQLHEIRSLLRLMDARARLVGDPEEISALRKEV 127

  Fly   136 HVALGNFCYIFYHIAYTSFLISNFLSFIMKRIHAWR-MYFP------YVDPEKQFYISSIAEVIL 193
            ::|.|.| ..|..|    |:....||.:...:...| :.:|      ::...:.:.:.:|.::..
  Fly   128 NIAQGTF-RTFASI----FVFGTTLSCVRVVVRPDRELLYPAWFGVDWMHSTRNYVLINIYQLFG 187

  Fly   194 RGWAVFMDLCTDVCPLISMVIARCHITLLKQRLRNL-----RSEPGRT----EDEYLKELADCVR 249
            .......:..:|..|...:.:...|:..|:.|:|.:     :|..|:|    .:|..:||.:|:|
  Fly   188 LIVQAIQNCASDSYPPAFLCLLTGHMRALELRVRRIGCRTEKSNKGQTYEAWREEVYQELIECIR 252

  Fly   250 D----HRLILDYVDALRSVFSGTIFVQFLLIGIVLGLSMINIMFFSTLSTGVAVVL---FMSCVS 307
            |    |||    .:.::.|.|.....||:....|.....::.::.:......|:::   |.|.|:
  Fly   253 DLARVHRL----REIIQRVLSVPCMAQFVCSAAVQCTVAMHFLYVADDHDHTAMIISIVFFSAVT 313

  Fly   308 MQTFPFCYLCNMIMDDCQEMADSLFQSDWTSADRRYKSTLVYFLHNLQQPIILTAGGVFPISMQT 372
            ::.|..||..:.:....:.:.|:.:..:|.....::|..|::.|...|:|.::.||....:|::|
  Fly   314 LEVFVICYFGDRMRTQSEALCDAFYDCNWIEQLPKFKRELLFTLARTQRPSLIYAGNYIALSLET 378

  Fly   373 NLNMVKLAFTVVTIV 387
            ...:::..::|.|::
  Fly   379 FEQVMRFTYSVFTLL 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22bNP_477425.1 7tm_6 81..381 CDD:251636 65/327 (20%)
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 66/330 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468637
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326193at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.