DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22b and Or1a

DIOPT Version :9

Sequence 1:NP_477425.1 Gene:Or22b / 33336 FlyBaseID:FBgn0026397 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_525029.2 Gene:Or1a / 30978 FlyBaseID:FBgn0029521 Length:392 Species:Drosophila melanogaster


Alignment Length:370 Identity:62/370 - (16%)
Similarity:119/370 - (32%) Gaps:129/370 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KSRDAFVYLDRVMWSF--------GWTVPENKRWDLHYKLWSTFV--TLLIFILLPISVSVEYIQ 73
            ||.|....:.::...|        .|. .:|:|..|...::....  |.:.|:|:|:::::    
  Fly    92 KSHDLVDLIQQIQSPFTEEDLVGTEWR-SQNQRGQLMAAIYFMMCAGTSVSFLLMPVALTM---- 151

  Fly    74 RFKTFSAGEFLSSIQIGVNMYGSSFKSYLTMMGYKKRQEAKMSLDELDKRCVCDEERTIVHRHVA 138
             .|..|.|||            :...|:..::.|                       .:...||.
  Fly   152 -LKYHSTGEF------------APVSSFRVLLPY-----------------------DVTQPHVY 180

  Fly   139 LGNFCYIFYHIAYTSFLISNFLSFIMKRIHAWRMYFPYVDPEKQFYISSIAEVILRGWAVFMDLC 203
            ..:.|.:.:           .|||                    |..|:.....|.||       
  Fly   181 AMDCCLMVF-----------VLSF--------------------FCCSTTGVDTLYGW------- 207

  Fly   204 TDVCPL-ISMVIARCHITLLKQRLRNLRS--EPGRTEDEYLKELADCVRDHRLILDYVDALRSVF 265
               |.| :|:...|     |.|:|:.:.|  .|.|::    ..|:....:|..:|..|......|
  Fly   208 ---CALGVSLQYRR-----LGQQLKRIPSCFNPSRSD----FGLSGIFVEHARLLKIVQHFNYSF 260

  Fly   266 SGTIFVQFLLI-GIVLGLSMINIM-----------FFSTLSTGVAVVLFMSCVSMQTFPFCYLCN 318
            ....||:.::| |:...:....||           |||      .||....|:      :.:...
  Fly   261 MEIAFVEVVIICGLYCSVICQYIMPHTNQNFAFLGFFS------LVVTTQLCI------YLFGAE 313

  Fly   319 MIMDDCQEMADSLFQ-SDWTSADRRYKSTLVYFLHNLQQPIILTA 362
            .:..:.:..:..|:: ..|.:...:::...::.:...|:..:|.|
  Fly   314 QVRLEAERFSRLLYEVIPWQNLPPKHRKLFLFPIERAQRETVLGA 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22bNP_477425.1 7tm_6 81..381 CDD:251636 48/298 (16%)
Or1aNP_525029.2 7tm_6 79..376 CDD:251636 62/370 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465649
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.