DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22b and Or69a

DIOPT Version :9

Sequence 1:NP_477425.1 Gene:Or22b / 33336 FlyBaseID:FBgn0026397 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster


Alignment Length:198 Identity:37/198 - (18%)
Similarity:83/198 - (41%) Gaps:23/198 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 TDVCPLISMVI----------ARCHITLLKQRLRNLRSEPGRTEDEYLKELADCVRDHRLILDYV 258
            |::|  ::|.|          ...|...|.::|..:.:.....:|: ||.|   :..|..:|:..
  Fly   203 TNMC--VNMFIQFLINFFGIQLEIHFDGLARQLETIDARNPHAKDQ-LKYL---IVYHTKLLNLA 261

  Fly   259 DALRSVFSGTIFVQF---LLIGIVLGLSMINIMFFSTLSTGVAVVLFMSCVSMQTFPFCYLCNMI 320
            |.:...|:.|..:..   ::....|..||....|.::|...:.::||::    ..|..|.....:
  Fly   262 DRVNRSFNFTFLISLSVSMISNCFLAFSMTMFDFGTSLKHLLGLLLFIT----YNFSMCRSGTHL 322

  Fly   321 MDDCQEMADSLFQSDWTSADRRYKSTLVYFLHNLQQPIILTAGGVFPISMQTNLNMVKLAFTVVT 385
            :....::..:.|.::|...|..|:..|:..:....:|.:.....:.|:|:.|.:..:|.::.:.|
  Fly   323 ILTSGKVLPAAFYNNWYEGDLVYRRMLLILMMRATKPYMWKTYKLAPVSITTYMATLKFSYQMFT 387

  Fly   386 IVK 388
            .|:
  Fly   388 CVR 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22bNP_477425.1 7tm_6 81..381 CDD:251636 35/189 (19%)
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 35/189 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466015
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.