DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22a and RIF2

DIOPT Version :9

Sequence 1:NP_523453.1 Gene:Or22a / 33335 FlyBaseID:FBgn0026398 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_013558.3 Gene:RIF2 / 851174 SGDID:S000004445 Length:395 Species:Saccharomyces cerevisiae


Alignment Length:399 Identity:70/399 - (17%)
Similarity:125/399 - (31%) Gaps:136/399 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 FVNIVMLILLPISISIE-----------------YLHRFKTFSAGEFLSSLEIGVNMYGSSFKCA 101
            |..:..|.|:||..|:.                 :..:||:      ::..|:|.|....|:..:
Yeast    36 FTVLRKLNLVPIKKSVSSPKVCKPSPVKERVDHVFYQKFKS------MALQELGTNYLSISYVPS 94

  Fly   102 FTLIGFKKRQEAK---VLLDQLDKRCLSDKERSTVHRYVAMGNFFDILYHIFYSTFVVMNFPYFL 163
            .:....|..:..|   |..|:::.          :|:|..:.........:.....|::....:|
Yeast    95 LSKFLSKNLRSMKNCIVFFDKVEH----------IHQYAGIDRAVSETLSLVDINVVIIEMNDYL 149

  Fly   164 LERRHAWRMYFPYIDSDEQFYISSIAECF-LMTEAIY---MDLCTDVCP------LISMLMARC- 217
            ::               |....|...||. .|.:|.|   :|......|      |:.|:|.:. 
Yeast   150 MK---------------EGIQSSKSKECIESMGQASYSGQLDFEASEKPSNHTSDLMMMVMRKIN 199

  Fly   218 ------HISLLKQRLRNLRSKPGRTEDEYLEEL-TECIRDHRLLLDYVDALRPV-------FSGT 268
                  ||...|              .|.|::| |..|.:...|.::::.|..:       |...
Yeast   200 NDESIDHIVYFK--------------FEQLDKLSTSTIIEPSKLTEFINVLSVLEKSNNIAFKVL 250

  Fly   269 IFVQFLLIGTVLGLSM------------------------INLMFFSTFWTG---------VATC 300
            |:...:.|.::|..|:                        :..|...||.:|         :.||
Yeast   251 IYSNNVSISSLLSTSLKKKLNTKYTVFEMPILTCAQEQEYLKKMIKFTFDSGSKLLQSYNSLVTC 315

  Fly   301 --------LFMFDVSMETF--PFCYLCNM---IIDDCQEMSNCLFQSDWTSADRRYKSTLVYFLH 352
                    |.:|...::.|  ||.||.|.   ||...:.....|.:.......:.|..:...|..
Yeast   316 QLNNKESNLAIFFEFLKVFPHPFTYLFNAYTEIIVQSRTFDELLDKIRNRLTIKNYPHSAYNFKK 380

  Fly   353 NLQQPITLT 361
            |.:.|:.||
Yeast   381 NQRLPLKLT 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22aNP_523453.1 7tm_6 81..381 CDD:251636 62/355 (17%)
RIF2NP_013558.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12555
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.