DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22a and Or98a

DIOPT Version :9

Sequence 1:NP_523453.1 Gene:Or22a / 33335 FlyBaseID:FBgn0026398 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster


Alignment Length:396 Identity:149/396 - (37%)
Similarity:236/396 - (59%) Gaps:11/396 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FPHIKEKPLSERVKSRDAFIYLDRVMWSFGWTEPENKRWILPYKLWLAFVNIVMLILLPISISIE 70
            |.::::...:..:.|.|:|.|.:..|:..||..|...:.|  |.:....:.....:.|||.|.|.
  Fly     3 FNYLRKPNPTNLLTSPDSFRYFEYGMFCMGWHTPATHKII--YYITSCLIFAWCAVYLPIGIIIS 65

  Fly    71 YLHRFKTFSAGEFLSSLEIGVNMYGSSFKCAF---TLIGFKKRQEAKVLLDQLDKRCLSDKERST 132
            :.....||:..|.|:.:::..|..|..||..|   .:.||.|   ||.||.::||||.:.|||..
  Fly    66 FKTDINTFTPNELLTVMQLFFNSVGMPFKVLFFNLYISGFYK---AKKLLSEMDKRCTTLKERVE 127

  Fly   133 VHRYVAMGNFFDILYHIFYSTFVVMNFPYFLLERRHAWRMYFPYID---SDEQFYISSIAECFLM 194
            ||:.|...|...::|...|:.:.:..|....|..:..||:|.|::|   |...|:.:::.|..||
  Fly   128 VHQGVVRCNKAYLIYQFIYTAYTISTFLSAALSGKLPWRIYNPFVDFRESRSSFWKAALNETALM 192

  Fly   195 TEAIYMDLCTDVCPLISMLMARCHISLLKQRLRNLRSKPGRTEDEYLEELTECIRDHRLLLDYVD 259
            ..|:...|.:|:.||:..|:.|.|:.||:.|:.:|.:..|:::.|..::|.:||:||.|::||..
  Fly   193 LFAVTQTLMSDIYPLLYGLILRVHLKLLRLRVESLCTDSGKSDAENEQDLIKCIKDHNLIIDYAA 257

  Fly   260 ALRPVFSGTIFVQFLLIGTVLGLSMINLMFFSTFWTGVATCLFMFDVSMETFPFCYLCNMIIDDC 324
            |:||..:.||||||||||..||||||||:||:..|||:||..::..:.::|||||::|:::..||
  Fly   258 AIRPAVTRTIFVQFLLIGICLGLSMINLLFFADIWTGLATVAYINGLMVQTFPFCFVCDLLKKDC 322

  Fly   325 QEMSNCLFQSDWTSADRRYKSTLVYFLHNLQQPITLTAGGVFPISMQTNLAMVKLAFSVVTVIKQ 389
            :.:.:.:|.|:|.::.|.|||:|.|||.|.|:.|..|||.:||||..:|:.:.||||||||.:.|
  Fly   323 ELLVSAIFHSNWINSSRSYKSSLRYFLKNAQKSIAFTAGSIFPISTGSNIKVAKLAFSVVTFVNQ 387

  Fly   390 FNLAER 395
            .|:|:|
  Fly   388 LNIADR 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22aNP_523453.1 7tm_6 81..381 CDD:251636 121/305 (40%)
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 121/307 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468540
Domainoid 1 1.000 64 1.000 Domainoid score I17159
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I7489
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D31412at7147
OrthoFinder 1 1.000 - - FOG0003850
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.