DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22a and Or94a

DIOPT Version :9

Sequence 1:NP_523453.1 Gene:Or22a / 33335 FlyBaseID:FBgn0026398 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_524455.1 Gene:Or94a / 42711 FlyBaseID:FBgn0039033 Length:387 Species:Drosophila melanogaster


Alignment Length:412 Identity:85/412 - (20%)
Similarity:160/412 - (38%) Gaps:75/412 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ERVKSRDAFIYLDRVMWSFG---WTEPENKRWILPYKLWLAFV--NIVMLILLPIS---ISIEYL 72
            :|::|....:   :||..||   |:....:.|     .:..||  |...|:.|||:   |.:.:|
  Fly     6 DRIESMRLIL---QVMQLFGLWPWSLKSEEEW-----TFTGFVKRNYRFLLHLPITFTFIGLMWL 62

  Fly    73 HRFKTFSAGEFLSSLE-IGVNMYGSSFKCAFT---LIGFKKRQEAKVLLDQL----DKRCLSDKE 129
            ..|       ..|:|| .|..:|.|..:.|..   |..:..|.||..|:.:|    |.:..:.:|
  Fly    63 EAF-------ISSNLEQAGQVLYMSITEMALVVKILSIWHYRTEAWRLMYELQHAPDYQLHNQEE 120

  Fly   130 RSTVHRYVAMGNFFDILYHIFYSTFVV--------------MNFPYFL-LERRHAWRMYFPYIDS 179
            .....|......:|..:| |..|..||              :.|.|:: .|.::..|.:|.|...
  Fly   121 VDFWRREQRFFKWFFYIY-ILISLGVVYSGCTGVLFLEGYELPFAYYVPFEWQNERRYWFAYGYD 184

  Fly   180 DEQFYISSIAECFLMTEAIYMDLCTDVCPLISMLMARCHISLLKQRLRNLR---SKPGRTEDEYL 241
            .....::.|:...|.|...|.               ..||||| .||..||   :|..:.:..:.
  Fly   185 MAGMTLTCISNITLDTLGCYF---------------LFHISLL-YRLLGLRLRETKNMKNDTIFG 233

  Fly   242 EELTECIRDHRLLLDYVDALRPVFSGTIFVQFLLIGTVLGLSMINLMFF------STFWTGVATC 300
            ::|......|:.:.......:.:.|..|..|.:|...::..|...|...      ..|   ::..
  Fly   234 QQLRAIFIMHQRIRSLTLTCQRIVSPYILSQIILSALIICFSGYRLQHVGIRDNPGQF---ISML 295

  Fly   301 LFMFDVSMETFPFCYLCNMIIDDCQEMSNCLFQSDWTSADRRYKSTLVYFLHNLQQPITLTAGGV 365
            .|:..:.::.:..||..|.|.....:::|.::.::|.......:..|..::.:|::|:|:.||..
  Fly   296 QFVSVMILQIYLPCYYGNEITVYANQLTNEVYHTNWLECRPPIRKLLNAYMEHLKKPVTIRAGNF 360

  Fly   366 FPISMQTNLAMVKLAFSVVTVI 387
            |.:.:...:..:..|:|.:.::
  Fly   361 FAVGLPIFVKTINNAYSFLALL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22aNP_523453.1 7tm_6 81..381 CDD:251636 65/331 (20%)
Or94aNP_524455.1 7tm_6 69..376 CDD:251636 64/326 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466099
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.