DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22a and Orco

DIOPT Version :9

Sequence 1:NP_523453.1 Gene:Or22a / 33335 FlyBaseID:FBgn0026398 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001097687.1 Gene:Orco / 40650 FlyBaseID:FBgn0037324 Length:486 Species:Drosophila melanogaster


Alignment Length:151 Identity:27/151 - (17%)
Similarity:57/151 - (37%) Gaps:16/151 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 IRDHRLLLDYVDALRPVFSGTIFVQFLLIGTVLGLSMINLMFFSTFWTGVATCLFMFDV------ 306
            :..|:.::..|.|:...:...:.:..|.....|.|    |.:.:|...||.  ::.|.|      
  Fly   342 VERHKHVVRLVAAIGDTYGAALLLHMLTSTIKLTL----LAYQATKINGVN--VYAFTVVGYLGY 400

  Fly   307 -SMETFPFCYLCNMIIDDCQEMSNCLFQSDWTSADRRYKSTLVYFLHNLQQPITLTAGGVFPISM 370
             ..:.|.||...|.:|::...:....:...|.......|:.:.......|:.::::....|.:|:
  Fly   401 ALAQVFHFCIFGNRLIEESSSVMEAAYSCHWYDGSEEAKTFVQIVCQQCQKAMSISGAKFFTVSL 465

  Fly   371 Q---TNLAMVKLAFSVVTVIK 388
            .   :.|..|...|.|:..:|
  Fly   466 DLFASVLGAVVTYFMVLVQLK 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22aNP_523453.1 7tm_6 81..381 CDD:251636 24/142 (17%)
OrcoNP_001097687.1 7tm_6 70..472 CDD:251636 22/135 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.