DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22a and Or83a

DIOPT Version :9

Sequence 1:NP_523453.1 Gene:Or22a / 33335 FlyBaseID:FBgn0026398 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_524234.2 Gene:Or83a / 40648 FlyBaseID:FBgn0037322 Length:453 Species:Drosophila melanogaster


Alignment Length:478 Identity:101/478 - (21%)
Similarity:188/478 - (39%) Gaps:109/478 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLSKFFPHIKEKPLSERVKSRDAFIYLDR-----VMWSFGWTEPENKRWI---------LPYKLW 51
            |.|.|    ||:.:.:..|.||.|:::.:     .|:.||:.  .|...:         |.|:|:
  Fly     1 MKSTF----KEERIKDDSKRRDLFVFVRQTMCIAAMYPFGYY--VNGSGVLAVLVRFCDLTYELF 59

  Fly    52 LAFVNIVMLILLPISISIEYLHRFKTFSAGEFLSSLEIGVNMYGSSFKCAFTL---IGFKKRQEA 113
            ..||::.:..|...:|.|.|         |:  ..|:..||....:....:|:   :.|::.:..
  Fly    60 NYFVSVHIAGLYICTIYINY---------GQ--GDLDFFVNCLIQTIIYLWTIAMKLYFRRFRPG 113

  Fly   114 KVLLDQLDKRCLSDKE-RSTV-HRYVAMGNFFDI--------LYHIFYSTFVVMNFPYFLLERRH 168
              ||:.:......:.| ||.| ..:|.|...:.:        :|..:..|...:..|....:|..
  Fly   114 --LLNTILSNINDEYETRSAVGFSFVTMAGSYRMSKLWIKTYVYCCYIGTIFWLALPIAYRDRSL 176

  Fly   169 AWRMYFPYIDSDEQFY----------ISSIAECFLMTEAIYMDLCT------DV--CPLISMLMA 215
            ....::|:..:....|          ...:|..|..:..::|.||.      ||  |.|.::| |
  Fly   177 PLACWYPFDYTQPGVYEVVFLLQAMGQIQVAASFASSSGLHMVLCVLISGQYDVLFCSLKNVL-A 240

  Fly   216 RCHISLLKQRLRNLRS----------KPGR-----TEDEYLEEL-----------------TECI 248
            ..:: |:...:..|..          :||:     .|:..|:||                 ..||
  Fly   241 SSYV-LMGANMTELNQLQAEQSAADVEPGQYAYSVEEETPLQELLKVGSSMDFSSAFRLSFVRCI 304

  Fly   249 RDHRLLLDYVDALRPVFSGTIFVQFLLIGTVLGLSMINLMFFST-------FWTGVATCLFMFDV 306
            :.||.:   |.||:.:.|....:.|:.||.|..| |..:.|.||       |...|:...::..|
  Fly   305 QHHRYI---VAALKKIESFYSPIWFVKIGEVTFL-MCLVAFVSTKSTAANSFMRMVSLGQYLLLV 365

  Fly   307 SMETFPFCYLCNMIIDDCQEMSNCLFQSDWTSADRRYKSTLVYFLHNLQQPITLTAGGVFPISMQ 371
            ..|.|..||..:::..:.|.....|::|.|....:..:|..::|:.|.::...||||.:..:::.
  Fly   366 LYELFIICYFADIVFQNSQRCGEALWRSPWQRHLKDVRSDYMFFMLNSRRQFQLTAGKISNLNVD 430

  Fly   372 TNLAMVKLAFSVVTVIKQFNLAE 394
            .....:..|||.:|::::.:..|
  Fly   431 RFRGTITTAFSFLTLLQKMDARE 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22aNP_523453.1 7tm_6 81..381 CDD:251636 74/369 (20%)
Or83aNP_524234.2 7tm_6 <155..440 CDD:251636 60/290 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.