DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22a and Or71a

DIOPT Version :9

Sequence 1:NP_523453.1 Gene:Or22a / 33335 FlyBaseID:FBgn0026398 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_524078.2 Gene:Or71a / 39641 FlyBaseID:FBgn0036474 Length:378 Species:Drosophila melanogaster


Alignment Length:246 Identity:55/246 - (22%)
Similarity:108/246 - (43%) Gaps:17/246 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 FVVMNFPYFLLERRHAWRMYFPYIDSDEQ----FYISSIAECFLMTEAIYMDLCTDVCPLISMLM 214
            |:|:. |.|.:..|..:.|:.|:   |.|    |:.:.|.:...:..|...::..|......|| 
  Fly   141 FIVIQ-PLFDIPNRLPFWMWTPF---DWQQPVLFWYAFIYQATTIPIACACNVTMDAVNWYLML- 200

  Fly   215 ARCHISLLKQRLRNLRSKPGRTEDEYLEELTECIRDHRLLLDYVDALRPVFSGTIFVQFLLIGTV 279
               |:||..:.|....||....:.:..|:..|.|..|:.|.....::....|.:.|.|.|:...:
  Fly   201 ---HLSLCLRMLGQRLSKLQHDDKDLREKFLELIHLHQRLKQQALSIEIFISKSTFTQILVSSLI 262

  Fly   280 LGLSMINLMFFSTF--WTGVATCL-FMFDVSMET-FPFCYLCNMIIDDCQEMSNCLFQSDWTSAD 340
            :..::.::......  ..|.|..: ::..:.|:. .|..| .|.:||....:::.::.|||...:
  Fly   263 ICFTIYSMQMSPVLQDLPGFAAMMQYLVAMIMQVMLPTIY-GNAVIDSANMLTDSMYNSDWPDMN 326

  Fly   341 RRYKSTLVYFLHNLQQPITLTAGGVFPISMQTNLAMVKLAFSVVTVIKQFN 391
            .|.:..::.|:..|.:|:||.|||.|.|.:......:..|:|::.::...|
  Fly   327 CRMRRLVLMFMVYLNRPVTLKAGGFFHIGLPLFTKTMNQAYSLLALLLNMN 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22aNP_523453.1 7tm_6 81..381 CDD:251636 52/234 (22%)
Or71aNP_524078.2 7tm_6 68..367 CDD:251636 52/234 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466101
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.