DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22a and Or67b

DIOPT Version :9

Sequence 1:NP_523453.1 Gene:Or22a / 33335 FlyBaseID:FBgn0026398 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_524007.2 Gene:Or67b / 39120 FlyBaseID:FBgn0036019 Length:421 Species:Drosophila melanogaster


Alignment Length:417 Identity:79/417 - (18%)
Similarity:151/417 - (36%) Gaps:101/417 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ILPYKLWLAFVNIVMLILLPISISI----------EYLHRFKTFSAGEFLS-SLEIG-VNMYGSS 97
            |.|.|....:..:..:::|.:::||          .|:..|:|:.....|: .|.:| |.|:...
  Fly    34 IAPRKRSSKYCRLTRILVLIVNLSIIYSLVAFIMENYMISFETYVEAVLLTFQLSVGVVKMFHFQ 98

  Fly    98 FK---CAFTLIGFKKRQEAKVL-LDQLD----KRCLSDKERSTVHRYVAMGN----FFDI----- 145
            .|   |:..:...:..:..|.| |.|||    |..||......::.::.:..    ||.|     
  Fly    99 NKVESCSQLVFSTETGEVLKSLGLFQLDLPRKKELLSSVSLILLNNWMIIDRQVMFFFKIVCMPV 163

  Fly   146 LYHIFYSTFVVMNFPYF------------LLERRHAWRMYFPYIDSDEQFYISSIAECFLMTEAI 198
            ||:...        |||            ..|....:....||:......:.|.:...||:... 
  Fly   164 LYYCVR--------PYFQYIFDCYIKDKDTCEMTLTYPAIVPYLQLGNYEFPSYVIRFFLLQSG- 219

  Fly   199 YMDLCTDVCPL-----------ISMLMARCH---ISLLKQRLRNLRSKPGRTEDEYLEELTECIR 249
                     ||           :.:::.|..   |.:|:..::|..|.....:|:.::.|..|:|
  Fly   220 ---------PLWCFFAVFGFNSLFVVLTRYESGLIKVLRFLVQNSTSDILVPKDQRVKYLQCCVR 275

  Fly   250 DHRLLLDYVDALRPVFSGTIFVQ---------FLL--IGTVLGLSMINLMFFSTFWTGVATCLFM 303
            ....:..:.:.:..:|...|.||         .||  |.|||.:..:        |.|:....|:
  Fly   276 LFARISSHHNQIENLFKYIILVQCSVSSILICMLLYKISTVLEVGWV--------WMGMIMVYFV 332

  Fly   304 FDVSMETFPFCYLCNMIIDDCQEMSNCLFQS----DWTSADRRYKSTLVYFLHNLQQPITLTAGG 364
             .:::|    ..|.|:.....:..|..||..    .|.:..|.:|..:...|...::...|:.||
  Fly   333 -TIALE----ITLYNVSAQKVESQSELLFHDWYNCSWYNESREFKFMIKMMLLFSRRTFVLSVGG 392

  Fly   365 VFPISMQTNLAMVKLAFSVVTVIKQFN 391
            ...:|.:..:.:.:|:.:...:::..|
  Fly   393 FTSLSHKFLVQVFRLSANFFLLLRNMN 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22aNP_523453.1 7tm_6 81..381 CDD:251636 69/359 (19%)
Or67bNP_524007.2 7tm_6 <197..408 CDD:251636 43/233 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465200
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.