DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22a and Or59b

DIOPT Version :9

Sequence 1:NP_523453.1 Gene:Or22a / 33335 FlyBaseID:FBgn0026398 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523822.1 Gene:Or59b / 37715 FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster


Alignment Length:395 Identity:168/395 - (42%)
Similarity:249/395 - (63%) Gaps:3/395 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FPHIKEKPLSERVKSRDAFIYLDRVMWSFGWTEPENKRWILPYKLWLAFVNIVMLILLPISISIE 70
            |..||..||:|:|:||...|||.|.||..||..|:.......|..|........:..||:...|.
  Fly     4 FKLIKPAPLTEKVQSRQGNIYLYRAMWLIGWIPPKEGVLRYVYLFWTCVPFAFGVFYLPVGFIIS 68

  Fly    71 YLHRFKTFSAGEFLSSLEIGVNMYGSSFKCAFTLIGFKKRQEAKVLLDQLDKRCLSDKERSTVHR 135
            |:..||.|:.||||:||::.:|:||:|.|...|.:...:.::.::|||.||||..:|.:|..:|.
  Fly    69 YVQEFKNFTPGEFLTSLQVCINVYGASVKSTITYLFLWRLRKTEILLDSLDKRLANDSDRERIHN 133

  Fly   136 YVAMGNFFDILYHIFYSTFVVMNFPYFLLERRHAWRMYFPYIDSDE---QFYISSIAECFLMTEA 197
            .||..|:..::|...|..:....|..:.|..|..|.:|.|:||..:   ..:|.:|.|...|:.|
  Fly   134 MVARCNYAFLIYSFIYCGYAGSTFLSYALSGRPPWSVYNPFIDWRDGMGSLWIQAIFEYITMSFA 198

  Fly   198 IYMDLCTDVCPLISMLMARCHISLLKQRLRNLRSKPGRTEDEYLEELTECIRDHRLLLDYVDALR 262
            :..|..:|..||:..:|.|.|:.:||..:|:||..|.|:|.:..::|..|:.||:.:|...|.:|
  Fly   199 VLQDQLSDTYPLMFTIMFRAHMEVLKDHVRSLRMDPERSEADNYQDLVNCVLDHKTILKCCDMIR 263

  Fly   263 PVFSGTIFVQFLLIGTVLGLSMINLMFFSTFWTGVATCLFMFDVSMETFPFCYLCNMIIDDCQEM 327
            |:.|.||||||.|||:||||:::|:.|||.||.|||:.||:..:.::||||||.|||:|||.|::
  Fly   264 PMISRTIFVQFALIGSVLGLTLVNVFFFSNFWKGVASLLFVITILLQTFPFCYTCNMLIDDAQDL 328

  Fly   328 SNCLFQSDWTSADRRYKSTLVYFLHNLQQPITLTAGGVFPISMQTNLAMVKLAFSVVTVIKQFNL 392
            ||.:|||:|..|:.|||:|||.|:|::||||...|||:|||||.:|:.:.|.|||::|:::|.||
  Fly   329 SNEIFQSNWVDAEPRYKATLVLFMHHVQQPIIFIAGGIFPISMNSNITVAKFAFSIITIVRQMNL 393

  Fly   393 AERFQ 397
            ||:||
  Fly   394 AEQFQ 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22aNP_523453.1 7tm_6 81..381 CDD:251636 130/302 (43%)
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 130/304 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468554
Domainoid 1 1.000 64 1.000 Domainoid score I17159
eggNOG 1 0.900 - - E1_2C9X1
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I7489
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D31412at7147
OrthoFinder 1 1.000 - - FOG0003850
OrthoInspector 1 1.000 - - otm50671
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.