DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22a and Or49b

DIOPT Version :9

Sequence 1:NP_523453.1 Gene:Or22a / 33335 FlyBaseID:FBgn0026398 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523721.1 Gene:Or49b / 36413 FlyBaseID:FBgn0028963 Length:375 Species:Drosophila melanogaster


Alignment Length:296 Identity:53/296 - (17%)
Similarity:122/296 - (41%) Gaps:53/296 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 LLDQLDKRCLSDKERSTVHRYVAMGN-FFDILYHIFYSTFV------VMNF------------PY 161
            :|||::|          |.:.:|.|| ||.:|..:.:..:.      |:.|            ||
  Fly   108 ILDQVNK----------VGKLMARGNLFFGMLTSMGFGLYPLSSSERVLPFGSKIPGLNEYESPY 162

  Fly   162 FLLERRHAWRMYFPYIDSDEQFYISSIAECFLMTEAIYMDLCTDVCPLISMLMARCHISLLKQRL 226
            :     ..|.::        |..|:.:..|      :|:...:.:..||...:.||  ..|:.||
  Fly   163 Y-----EMWYIF--------QMLITPMGCC------MYIPYTSLIVGLIMFGIVRC--KALQHRL 206

  Fly   227 RNLRSK---PGRTEDEYLEELTECIRDHRLLLDYVDALRPVFSGTIFVQFLLIGTVLGLSMINLM 288
            |.:..|   ..|...|..||:..|||..:.:::|:|.:..:.:.....:.:....:|...:..|:
  Fly   207 RQVALKHPYGDRDPRELREEIIACIRYQQSIIEYMDHINELTTMMFLFELMAFSALLCALLFMLI 271

  Fly   289 FFSTFWTGVATCLFMFDVSMETFPFCYLCNMIIDDCQEMSNCLFQSDWTSADRRYKSTLVYFLHN 353
            ..|.....:..|:::..:..:.....:..|.:.:....::...::::|.:.|...:..:::.:..
  Fly   272 IVSGTSQLIIVCMYINMILAQILALYWYANELREQNLAVATAAYETEWFTFDVPLRKNILFMMMR 336

  Fly   354 LQQPITLTAGGVFPISMQTNLAMVKLAFSVVTVIKQ 389
            .|:|..:..|.:.||:::....::...::..||:|:
  Fly   337 AQRPAAILLGNIRPITLELFQNLLNTTYTFFTVLKR 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22aNP_523453.1 7tm_6 81..381 CDD:251636 50/286 (17%)
Or49bNP_523721.1 7tm_6 53..364 CDD:251636 50/286 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465796
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.