DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22a and Or43b

DIOPT Version :9

Sequence 1:NP_523453.1 Gene:Or22a / 33335 FlyBaseID:FBgn0026398 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523656.2 Gene:Or43b / 35743 FlyBaseID:FBgn0026393 Length:403 Species:Drosophila melanogaster


Alignment Length:407 Identity:140/407 - (34%)
Similarity:220/407 - (54%) Gaps:27/407 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FPHIK---EKPLSERVKSRDAFIYLDRVMWSFGWTEPENKRWILPYKLWLAFVNIVMLILLPISI 67
            |.|.|   ..|:||.::|||:..|:...:.:.|.....:  :.:..|:|..|.....:::||:|.
  Fly     2 FGHFKLVYPAPISEPIQSRDSNAYMMETLRNSGLNLKND--FGIGRKIWRVFSFTYNMVILPVSF 64

  Fly    68 SIEYLHRFKTFSAGEFLSSLEIGVNMYGSSFKCAFTLIGFKKRQE-AKVLLDQLDKRCLSDKERS 131
            .|.|:.....|.....|.||::.:|.:..:.| .||||.:..|.| |....|:|||.|:...|:.
  Fly    65 PINYVIHLAEFPPELLLQSLQLCLNTWCFALK-FFTLIVYTHRLELANKHFDELDKYCVKPAEKR 128

  Fly   132 TVHRYVAMGNFFDILYHIFYSTFVVMNFPYF-------LLERRHAWRMYFPYID---SDEQFYIS 186
            .|...||       .....|.||||:...|.       ||..|..:..|:|:|:   ...|.||.
  Fly   129 KVRDMVA-------TITRLYLTFVVVYVLYATSTLLDGLLHHRVPYNTYYPFINWRVDRTQMYIQ 186

  Fly   187 SIAECFLMTEAIYMDLCTDVCPLISMLMARCHISLLKQRLRNL--RSKPGRTEDEYL-EELTECI 248
            |..|.|.:..|||:...||..|:|.:...|.||.|||.|:..|  .|..|.::..|: :.|.:||
  Fly   187 SFLEYFTVGYAIYVATATDSYPVIYVAALRTHILLLKDRIIYLGDPSNEGSSDPSYMFKSLVDCI 251

  Fly   249 RDHRLLLDYVDALRPVFSGTIFVQFLLIGTVLGLSMINLMFFSTFWTGVATCLFMFDVSMETFPF 313
            :.||.:|::.||::|:.|||||.||::.|::||:.|||::.|:...|.....:::..|.::|||.
  Fly   252 KAHRTMLNFCDAIQPIISGTIFAQFIICGSILGIIMINMVLFADQSTRFGIVIYVMAVLLQTFPL 316

  Fly   314 CYLCNMIIDDCQEMSNCLFQSDWTSADRRYKSTLVYFLHNLQQPITLTAGGVFPISMQTNLAMVK 378
            |:.||.|:|||:|:::.||.|.|...|:||:.|::.||..||||:|.||..:|.|::.||:.:.|
  Fly   317 CFYCNAIVDDCKELAHALFHSAWWVQDKRYQRTVIQFLQKLQQPMTFTAMNIFNINLATNINVAK 381

  Fly   379 LAFSVVTVIKQFNLAER 395
            .||:|..:....||.::
  Fly   382 FAFTVYAIASGMNLDQK 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22aNP_523453.1 7tm_6 81..381 CDD:251636 115/313 (37%)
Or43bNP_523656.2 7tm_6 95..384 CDD:251636 111/296 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468561
Domainoid 1 1.000 64 1.000 Domainoid score I17159
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I7489
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D31412at7147
OrthoFinder 1 1.000 - - FOG0003850
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.