DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22a and Or24a

DIOPT Version :9

Sequence 1:NP_523453.1 Gene:Or22a / 33335 FlyBaseID:FBgn0026398 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster


Alignment Length:412 Identity:80/412 - (19%)
Similarity:152/412 - (36%) Gaps:109/412 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PENKRWILPYKLWLAFVNIVMLI------------LLPISI--SIEYLHRFKTFSAGEFLSSLE- 88
            ||.||.:| .||| :|.|..:|.            .:||:|  :::.|...    |...||.:: 
  Fly    31 PEQKRTVL-VKLW-SFFNFFILTYGCYAEAYYGIHYIPINIATALDALCPV----ASSILSLVKM 89

  Fly    89 IGVNMYGSSFKCAFTLIGFKKRQEAKVLLDQLDKRCLSDKERSTVHRYVAMGNFFDILYHIFY-- 151
            :.:..|....:.....:.|...|       |..||.|..|:|           |:.:...:.:  
  Fly    90 VAIWWYQDELRSLIERVRFLTEQ-------QKSKRKLGYKKR-----------FYTLATQLTFLL 136

  Fly   152 --------STFVVMNFPYFLLERRHA--W------RMYFP------------YIDSDEQFYISSI 188
                    :::.|.:....:|.|.|.  |      :|.||            ||......||:.:
  Fly   137 LCCGFCTSTSYSVRHLIDNILRRTHGKDWIYETPFKMMFPDLLLRLPLYPITYILVHWHGYITVV 201

  Fly   189 AECFLMTEAIYMDLC-----------TDVCPLISMLMARCHISLLKQRLRNLRSKPGRTED-EYL 241
              ||:..:..::..|           .|||.|:              .:.|:...|...|: ..:
  Fly   202 --CFVGADGFFLGFCLYFTVLLLCLQDDVCDLL--------------EVENIEKSPSEAEEARIV 250

  Fly   242 EELTECIRDHRLLLDYVDALRPVFSGTIFVQFLLIGTVLGLSMINLMFFSTFWTG-----VATCL 301
            .|:.:.:..|..:.:..:.|..|........|:....::|.|:::::.||..  |     |.||.
  Fly   251 REMEKLVDRHNEVAELTERLSGVMVEITLAHFVTSSLIIGTSVVDILLFSGL--GIIVYVVYTCA 313

  Fly   302 FMFDVSMETFPFCYLCNMIIDDCQEMSNCLFQSDWTSADRRYKSTLVYFLHNLQQPITLTAGGVF 366
                |.:|.|.:|...:.|::.|..::...|.|.|.....|.:...:..:...|:.:|:.. ..|
  Fly   314 ----VGVEIFLYCLGGSHIMEACSNLARSTFSSHWYGHSVRVQKMTLLMVARAQRVLTIKI-PFF 373

  Fly   367 PISMQTNLAMVKLAFSVVTVIK 388
            ..|::|..::::...|::.:.|
  Fly   374 SPSLETLTSILRFTGSLIALAK 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22aNP_523453.1 7tm_6 81..381 CDD:251636 62/347 (18%)
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 65/364 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465164
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.