DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22a and Or22c

DIOPT Version :9

Sequence 1:NP_523453.1 Gene:Or22a / 33335 FlyBaseID:FBgn0026398 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523454.2 Gene:Or22c / 33381 FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster


Alignment Length:315 Identity:62/315 - (19%)
Similarity:130/315 - (41%) Gaps:61/315 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 KRQEAKVLL-------DQLDKRCLSDKERST-----------VHRY-VAMGNFFDILYHIFYSTF 154
            :||||:.:|       ::|....||....:.           ::|: |.:....::.::|...:|
  Fly   115 RRQEAQRMLVGLATTANRLSLLLLSSGTATNAAFTLQPLIMGLYRWIVQLPGQTELPFNIILPSF 179

  Fly   155 VVMN--FP--YFLLERRHAWRMY-FPYIDSDEQFYISSIAECFLMTEAIYMDLCTDVCPLISMLM 214
            .|..  ||  |.||....|..:: |.::|.   |:|.|               |..:|..     
  Fly   180 AVQPGVFPLTYVLLTASGACTVFAFSFVDG---FFICS---------------CLYICGA----- 221

  Fly   215 ARCHISLLKQRLRNL-RSKPGRTEDEYLEE--------LTECIRDHRLLLDYVDALRPVFSGTIF 270
                ..|::|.:|.: ....|.:.|.:.||        |.:.:..|..::|:...|...|:..:.
  Fly   222 ----FRLVQQDIRRIFADLHGDSVDVFTEEMNAEVRHRLAQVVERHNAIIDFCTDLTRQFTVIVL 282

  Fly   271 VQFLLIGTVLGLSMINLMFFSTFWTGVATCLFMFDVSMETFPFCYLCNMIIDDCQEMSNCLFQSD 335
            :.||....||..:::::|..::..:|:....::.....:.|.:|:..|.:.:....:::.|:..:
  Fly   283 MHFLSAAFVLCSTILDIMLNTSSLSGLTYICYIIAALTQLFLYCFGGNHVSESSAAVADVLYDME 347

  Fly   336 WTSADRRYKSTLVYFLHNLQQPITLTAGGVFPISMQTNLAMVKLAFSVVTVIKQF 390
            |...|.|.:..::..|...|:..|: |...|..|:....:::..|.|.:|::|.|
  Fly   348 WYKCDARTRKVILMILRRSQRAKTI-AVPFFTPSLPALRSILSTAGSYITLLKTF 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22aNP_523453.1 7tm_6 81..381 CDD:251636 57/304 (19%)
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 57/304 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465110
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.