DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22a and Or10a

DIOPT Version :9

Sequence 1:NP_523453.1 Gene:Or22a / 33335 FlyBaseID:FBgn0026398 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster


Alignment Length:411 Identity:77/411 - (18%)
Similarity:161/411 - (39%) Gaps:93/411 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 WTEPENKRWILPYKLWLAFVNIVMLILLPISISIEYLHRFKTFSAGE-FLSSLEIGVNM-----Y 94
            |.......|  |::      :::...:|.|.::.| ||      ||. ||...:|.:.:     .
  Fly    32 WPGKTGDTW--PWR------SLIHFAILAIGVATE-LH------AGMCFLDRQQITLALETLCPA 81

  Fly    95 GSSFKCAFTLIG----FKKRQEAKVLLDQL-----DKRCLSDKERSTVHRYVAMG---NFFD--- 144
            |:|   |.||:.    .:.||:..::.::|     |......::|....::.||.   ||:.   
  Fly    82 GTS---AVTLLKMFLMLRFRQDLSIMWNRLRGLLFDPNWERPEQRDIRLKHSAMAARINFWPLSA 143

  Fly   145 -----------------ILY-------HIFYSTF------VVMNFPYFLLERRHAWRMYFPYIDS 179
                             |||       .::::.|      |::|:|:|.|  .:.:..|..|:. 
  Fly   144 GFFTCTTYNLKPILIAMILYLQNRYEDFVWFTPFNMTMPKVLLNYPFFPL--TYIFIAYTGYVT- 205

  Fly   180 DEQFYISSIAECFLMTEAIYMDLCTDVCPLISMLMARCHISLLKQRLRNLRSKPGRTEDEYL--E 242
                 |.....|    :..|.:.|..:..|..:|.|... |:.:....:|...|.:.   |:  :
  Fly   206 -----IFMFGGC----DGFYFEFCAHLSALFEVLQAEIE-SMFRPYTDHLELSPVQL---YILEQ 257

  Fly   243 ELTECIRDHRLLLDYVDALRPVFSGTIFVQFLLIGTVLGLSMINLMFFSTFWTGVATCLFM-FDV 306
            ::...|..|..::|.....|..::......|:....|:|.||:||:....  .|:...|:: :.|
  Fly   258 KMRSVIIRHNAIIDLTRFFRDRYTIITLAHFVSAAMVIGFSMVNLLTLGN--NGLGAMLYVAYTV 320

  Fly   307 S--METFPFCYLCNMIIDDCQEMSNCLFQSDWTSADRRYKSTLVYFLHNLQQPITLTAGGVFPIS 369
            :  .:...:||...::.:....:...:|...|.....:.:..:...:...|:|::: |...|..|
  Fly   321 AALSQLLVYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSM-AVPFFSPS 384

  Fly   370 MQTNLAMVKLAFSVVTVIKQF 390
            :.|..|:::.:.|::.::|.|
  Fly   385 LATFAAILQTSGSIIALVKSF 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22aNP_523453.1 7tm_6 81..381 CDD:251636 65/355 (18%)
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 62/347 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465128
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.