DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22a and Or9a

DIOPT Version :9

Sequence 1:NP_523453.1 Gene:Or22a / 33335 FlyBaseID:FBgn0026398 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster


Alignment Length:435 Identity:89/435 - (20%)
Similarity:161/435 - (37%) Gaps:100/435 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IKEKPLSERVKSRDAFIYLDRVMWSFGWTEP-ENKRWILPYKLWLAFVNI--VMLILLPISISIE 70
            :|.|...|:.:|....|.:.|.|....|:.. .|.|   |   ||.||.:  :.|.::|:.:   
  Fly     5 VKGKKQEEKDQSLRVQILVYRCMGIDLWSPTMANDR---P---WLTFVTMGPLFLFMVPMFL--- 60

  Fly    71 YLHRFKTFSAGEFLSSLEIGVNMYGSSFKCAFTLIGF------KKR-------------QEAKVL 116
                    :|.|:::.:.:..:..||:|....||:.|      :|.             :|.:|.
  Fly    61 --------AAHEYITQVSLLSDTLGSTFASMLTLVKFLLFCYHRKEFVGLIYHIRAILAKEIEVW 117

  Fly   117 LDQ---LDKRCLSDKERSTVHR--------YVAMGNFFDILYHIFYSTFVVMNFPYFLLERRHAW 170
            .|.   ::....||:..|..:.        :.|:..|..|:........:.:..|:         
  Fly   118 PDAREIIEVENQSDQMLSLTYTRCFGLAGIFAALKPFVGIILSSIRGDEIHLELPH--------- 173

  Fly   171 RMYFPYIDSDEQFYISS-IAECFLMTEAIYMDLCTD---------VCPLISMLMARCHISLLKQR 225
            ...:||......||:.: :........|:.|.||.|         ||.:         ..:.|.|
  Fly   174 NGVYPYDLQVVMFYVPTYLWNVMASYSAVTMALCVDSLLFFFTYNVCAI---------FKIAKHR 229

  Fly   226 LRNLRSKPGRTEDEYLEELTECIRDHRLLLDYVDALRPVFSGTIFVQFLLIG---TVLGLSMINL 287
            :.:|.:..|:.|   ||.|.:.:..|:..|...|.:...:...||:||.|..   ..:|..:.:|
  Fly   230 MIHLPAVGGKEE---LEGLVQVLLLHQKGLQIADHIADKYRPLIFLQFFLSALQICFIGFQVADL 291

  Fly   288 ------MFFSTFWTGVATCLFMFDVSMETFPFCYLCNMIIDDCQEMSNCLFQSDWTSADRRYKST 346
                  ::|..|...:...||::....|......|         :..|.|::::||......|..
  Fly   292 FPNPQSLYFIAFVGSLLIALFIYSKCGENIKSASL---------DFGNGLYETNWTDFSPPTKRA 347

  Fly   347 LVYFLHNLQQPITLTAGGVFPISMQTNLAMVKLAFSVVTVIKQFN 391
            |:......|:|..: .|..|..||.|...:|:.|.|.:.:::.||
  Fly   348 LLIAAMRAQRPCQM-KGYFFEASMATFSTIVRSAVSYIMMLRSFN 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22aNP_523453.1 7tm_6 81..381 CDD:251636 67/348 (19%)
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 66/343 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465594
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.