DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22a and Or65c

DIOPT Version :9

Sequence 1:NP_523453.1 Gene:Or22a / 33335 FlyBaseID:FBgn0026398 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster


Alignment Length:300 Identity:63/300 - (21%)
Similarity:102/300 - (34%) Gaps:126/300 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LSERVK-SRD-----AFIYLDRVMWSFGWTEPE--------------------------NKRW-- 44
            |.::|: .||     .|.|:...::.|.|...|                          .|||  
  Fly    83 LGDKVQMGRDIAFIIGFFYIAFKIYYFQWYGDELDEVVEALETFHPWAQKGPGAVDYRTAKRWYF 147

  Fly    45 ILPYKL---WLAFVNIVMLIL-----------LPI--------------SISIEYLHRFKTFSAG 81
            .|.:.|   ||.|:.|.:|:|           ||:              .||..:::.|:|::..
  Fly   148 TLAFFLASSWLVFLCIFILLLITSPLWVHQQILPLHAAFPFQWHEKSIHPISHAFIYLFQTWNVM 212

  Fly    82 EFLSSL----EIGVNMYGSSFKCAFTLIGFKKRQEAKVL---LDQLDKRCLS-DKERSTVHRYVA 138
            .||:.|    .:.|::|   .:..|.:         :||   |..|.:||.. ::.|...:|.| 
  Fly   213 YFLTWLVCIEGLSVSIY---VEITFAI---------EVLCLELRHLHQRCHGYEQLRLETNRLV- 264

  Fly   139 MGNFFDILYHI-------FYSTFVV-MNFPYFL-----LERRHA--------------------- 169
              .|...:.||       |:.|.:: |...:||     ||...|                     
  Fly   265 --QFHQKIVHILDHTNKVFHGTLIMQMGVNFFLVSLSVLEAMEARKDPKVVAQFAVLMLLALGHL 327

  Fly   170 --WRMYFPYIDSDEQFYISSIA----ECFLMTEAIYMDLC 203
              | .||..:.|.:...||..|    :....::.:|.|||
  Fly   328 SMW-SYFGDLLSQKSLTISEAAYEAYDPIKGSKDVYRDLC 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22aNP_523453.1 7tm_6 81..381 CDD:251636 36/170 (21%)
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 61/295 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465218
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.