DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or22a and Or69a

DIOPT Version :9

Sequence 1:NP_523453.1 Gene:Or22a / 33335 FlyBaseID:FBgn0026398 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster


Alignment Length:410 Identity:82/410 - (20%)
Similarity:160/410 - (39%) Gaps:86/410 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LDRVMWSFGWTEPENKRWILPYKL-WLAFVNIVMLILLPISISIEYLHRFKTFSAGEFLSSLEIG 90
            |.|..|: |....|.||.:....: ||..||:|...:  ..:...|....:|.....:|:.|...
  Fly    19 LPRYTWN-GRRSLEVKRNLAKRIIFWLGAVNLVYHNI--GCVMYGYFGDGRTKDPIAYLAELASV 80

  Fly    91 VNMYGSSFKCAFTLIG-------FKKRQEAKVLLDQLDKRCLSDKERS-TVHRYVA-----MGNF 142
            .:|.|      ||::|       ...:...:.||::.::.....|.|: .:|.|..     :.|.
  Fly    81 ASMLG------FTIVGTLNLWKMLSLKTHFENLLNEFEELFQLIKHRAYRIHHYQEKYTRHIRNT 139

  Fly   143 FDILYHIFYSTFVVM--NFPYFLLERRH-------AWRM----YFPY-IDSDEQFYISSIAECFL 193
            |     ||:::.||.  :.|..|:.|.|       .:|:    ::|: :......:.:::| |.:
  Fly   140 F-----IFHTSAVVYYNSLPILLMIREHFSNSQQLGYRIQSNTWYPWQVQGSIPGFFAAVA-CQI 198

  Fly   194 MTEAIYMDLC-TDVCP------LISM--LMARCHISLLKQRLRNLRSKPGRTEDEYLEELTECIR 249
            .:       | |::|.      ||:.  :....|...|.::|..:.::....:|    :|...|.
  Fly   199 FS-------CQTNMCVNMFIQFLINFFGIQLEIHFDGLARQLETIDARNPHAKD----QLKYLIV 252

  Fly   250 DHRLLLDYVDALRPVFSGTIFVQFLLIGTVLGLSMINLMFFSTFWTGVATCLFMFDVSME----- 309
            .|..||:..|.:...|:.|..:.       |.:|||:..|.:...|     :|.|..|::     
  Fly   253 YHTKLLNLADRVNRSFNFTFLIS-------LSVSMISNCFLAFSMT-----MFDFGTSLKHLLGL 305

  Fly   310 ------TFPFCYLCNMIIDDCQEMSNCLFQSDWTSADRRYKSTLVYFLHNLQQPITLTAGGVFPI 368
                  .|..|.....:|....::....|.::|...|..|:..|:..:....:|.......:.|:
  Fly   306 LLFITYNFSMCRSGTHLILTSGKVLPAAFYNNWYEGDLVYRRMLLILMMRATKPYMWKTYKLAPV 370

  Fly   369 SMQTNLAMVKLAFSVVTVIK 388
            |:.|.:|.:|.::.:.|.::
  Fly   371 SITTYMATLKFSYQMFTCVR 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or22aNP_523453.1 7tm_6 81..381 CDD:251636 67/346 (19%)
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 67/343 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466002
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.