DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment halo and CG34266

DIOPT Version :10

Sequence 1:NP_001137765.1 Gene:halo / 33334 FlyBaseID:FBgn0001174 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_001097507.1 Gene:CG34266 / 5740465 FlyBaseID:FBgn0085295 Length:88 Species:Drosophila melanogaster


Alignment Length:79 Identity:27/79 - (34%)
Similarity:45/79 - (56%) Gaps:7/79 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SLHYTLFAYREELRRRDAPFMKMSTIKLHLTDNLILQTIKNIRQYDTIEIMNLNQEINFKRRL-- 80
            |:.|.||.:|:|||||...::|:|..|:.||..||.:..:.:......::..||:|..|||:|  
  Fly     4 SVAYALFLHRQELRRRQMLYVKVSKTKILLTKELIAEQRQRLANCSPEDLQILNRETQFKRQLQQ 68

  Fly    81 -----TKQMRKVRK 89
                 :||::.:.|
  Fly    69 KLKHRSKQLKAIAK 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
haloNP_001137765.1 DUF733 17..100 CDD:428418 27/79 (34%)
CG34266NP_001097507.1 DUF733 2..86 CDD:428418 27/79 (34%)

Return to query results.
Submit another query.