DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and EPS1

DIOPT Version :10

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_012261.1 Gene:EPS1 / 854812 SGDID:S000001267 Length:701 Species:Saccharomyces cerevisiae


Alignment Length:167 Identity:40/167 - (23%)
Similarity:60/167 - (35%) Gaps:43/167 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FRCIYFLFSLLIWSAQSDKSLSKQSGNVTTITNLSVKARSADQCTPGTILKLRVDNFFETTEDGT 68
            |.||.||....|.:|:..:...:                           .|...||.|....|.
Yeast    13 FSCITFLLKFTIAAAEPPEGFPE---------------------------PLNPTNFKEELSKGL 50

  Fly    69 FFVKFYEPNCMGCHDFETTWTDMAKSFKSKE---NICFAELNCKFAKTICNDYELRYEPNLIWLE 130
            ..:.||.|.|..|......|.:..:.||.:.   ||.|:::||..:..:|.|..:.|.|      
Yeast    51 HIIDFYSPYCPHCKHLAPVWMETWEEFKEESKTLNITFSQVNCIESADLCGDENIEYFP------ 109

  Fly   131 NGEEVQQYDGDLTSPGIKIFVWEMIRRNETNKSAAKR 167
               |::.|:   .|..||.|. |..|..|:..:.|:|
Yeast   110 ---EIRLYN---PSGYIKSFT-ETPRTKESLIAFARR 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 51..151 CDD:469754 27/102 (26%)
EPS1NP_012261.1 Thioredoxin 33..139 CDD:395038 32/145 (22%)
PTZ00102 <404..>472 CDD:240266
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.