DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and PDI1

DIOPT Version :10

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_009887.1 Gene:PDI1 / 850314 SGDID:S000000548 Length:522 Species:Saccharomyces cerevisiae


Alignment Length:111 Identity:26/111 - (23%)
Similarity:53/111 - (47%) Gaps:7/111 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ILKLRVDNFFETTED-GTFFVKFYEPNCMGCHDFETTWTDMAKSFKSKENICFAELNCKFAKTIC 115
            ::||..|:|.|..:. .....:|:.|.|..|.:....:...|::...| ||..|:::|...:.:|
Yeast    34 VVKLATDSFNEYIQSHDLVLAEFFAPWCGHCKNMAPEYVKAAETLVEK-NITLAQIDCTENQDLC 97

  Fly   116 NDYELRYEPNLIWLENGE--EVQQYDGDLTSPGIKIFVWEMIRRNE 159
            .::.:...|:|...:|.:  ....|:|..|:..|..|   ||::::
Yeast    98 MEHNIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQF---MIKQSQ 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 51..151 CDD:469754 23/101 (23%)
PDI1NP_009887.1 ER_PDI_fam 32..492 CDD:273457 26/111 (23%)

Return to query results.
Submit another query.