DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and APR2

DIOPT Version :10

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_176409.1 Gene:APR2 / 842514 AraportID:AT1G62180 Length:454 Species:Arabidopsis thaliana


Alignment Length:72 Identity:16/72 - (22%)
Similarity:29/72 - (40%) Gaps:17/72 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QSGNVTTITNLSVKARSADQCTPGTILKLRVDNFFETTEDGTFFVKFYEPNCMGCHDFETTWTDM 91
            :|.||..::...|:          .:|||      |..:: .:.|..|.|.|..|...|.::.::
plant   340 ESNNVVALSKGGVE----------NLLKL------ENRKE-AWLVVLYAPWCPFCQAMEASYIEL 387

  Fly    92 AKSFKSK 98
            |:....|
plant   388 AEKLAGK 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 51..151 CDD:469754 12/48 (25%)
APR2NP_176409.1 APS_reduc 1..454 CDD:273072 16/72 (22%)

Return to query results.
Submit another query.