DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and PDIL5-2

DIOPT Version :10

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_564462.1 Gene:PDIL5-2 / 840461 AraportID:AT1G35620 Length:440 Species:Arabidopsis thaliana


Alignment Length:149 Identity:43/149 - (28%)
Similarity:61/149 - (40%) Gaps:27/149 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLIWSAQSDKSLSKQSGNVTTIT-NLSVKARSADQCT-PGTILKLRVDNFFETTEDGTF---FVK 72
            ||.|              ::.:| ::|:.|.|.||.| .||:|:|...||  .:...||   ||.
plant     7 LLCW--------------ISFLTLSISISASSDDQFTLDGTVLELTDSNF--DSAISTFDCIFVD 55

  Fly    73 FYEPNCMGCHDFETTWTDMAKSF--KSKENICFAELNCKFAKTICNDYELRYEPNLIWLENGEEV 135
            ||.|.|..|...... .|.|...  |.|:.|..|:||......:....|:...|.|:...:|..:
plant    56 FYAPWCGHCKRLNPE-LDAAAPILAKLKQPIVIAKLNADKYSRLARKIEIDAFPTLMLYNHGVPM 119

  Fly   136 QQY---DGDLTSPGIKIFV 151
            :.|   ..||....:|.||
plant   120 EYYGPRKADLLVRYLKKFV 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 51..151 CDD:469754 30/107 (28%)
PDIL5-2NP_564462.1 ER_PDI_fam 34..>327 CDD:273457 31/108 (29%)

Return to query results.
Submit another query.