DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and PDIL2-2

DIOPT Version :10

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_171990.3 Gene:PDIL2-2 / 839355 AraportID:AT1G04980 Length:447 Species:Arabidopsis thaliana


Alignment Length:107 Identity:26/107 - (24%)
Similarity:44/107 - (41%) Gaps:4/107 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ILKLRVDNFFE--TTEDGTFFVKFYEPNCMGCHDFETTWTDMAKSFKSKENICFAELNCKFAKTI 114
            :|:|...||..  ...:|...|:|:.|.|..|.....||..:|.:.|....:  |.::....|::
plant    34 VLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQSLTPTWEKVASTLKGIATV--AAIDADAHKSV 96

  Fly   115 CNDYELRYEPNLIWLENGEEVQQYDGDLTSPGIKIFVWEMIR 156
            ..||.:|..|.:.....|:....|.|...:..|..|..:.|:
plant    97 SQDYGVRGFPTIKVFVPGKPPIDYQGARDAKSISQFAIKQIK 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 51..151 CDD:469754 24/100 (24%)
PDIL2-2NP_171990.3 PDI_a_P5 33..134 CDD:239299 25/101 (25%)
PDI_a_P5 168..270 CDD:239299
P5_C 279..408 CDD:239281
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.