DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and PDIL5-1

DIOPT Version :9

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001318951.1 Gene:PDIL5-1 / 837311 AraportID:AT1G07960 Length:146 Species:Arabidopsis thaliana


Alignment Length:117 Identity:35/117 - (29%)
Similarity:55/117 - (47%) Gaps:7/117 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ILKLRVDNFFE--TTEDGTFFVKFYEPNCMGCHDFETTWTDMAKSFKSKENICFAELNCKFAKTI 114
            ::.|..:.|.:  ..:|..:||||..|.|..|......|.|:.|:.:..:.|...|::|..::.:
plant    27 VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKLGNLWEDLGKAMEGDDEIEVGEVDCGTSRAV 91

  Fly   115 CNDYELRYEPNLIWLENGEEVQQYDGDLTSPGIKIFVWEMIRRNETNKSAAK 166
            |...|:...|..:...|||||.:|.|......:|.||.|     ||.|:|.|
plant    92 CTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVVE-----ETEKAAEK 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Thioredoxin_like 51..151 CDD:294274 27/100 (27%)
PDIL5-1NP_001318951.1 Thioredoxin_like 27..128 CDD:412351 27/100 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2530
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000934
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.