DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and APR3

DIOPT Version :10

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_193930.1 Gene:APR3 / 828288 AraportID:AT4G21990 Length:458 Species:Arabidopsis thaliana


Alignment Length:113 Identity:22/113 - (19%)
Similarity:35/113 - (30%) Gaps:29/113 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 WSAQSDKSLSKQSGNVTTIT------NLSVKARSADQCTPGTILKLR---VDNFFE-TTEDGTFF 70
            |.....|......||:...|      |::..|..||......::.|.   ::|..: ......:.
plant   306 WEDAKAKECGLHKGNIKENTNGNATANVNGTASVADIFNSENVVNLSRQGIENLMKLENRKEAWI 370

  Fly    71 VKFYEPNCMGCHDFETTWTDMA-------------------KSFKSKE 99
            |..|.|.|..|...|.::.::|                   |.|..||
plant   371 VVLYAPWCPFCQAMEASFDELADKLGGSGVKVAKFRADGDQKDFAKKE 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 51..151 CDD:469754 13/72 (18%)
APR3NP_193930.1 PLN02309 24..458 CDD:215175 22/113 (19%)

Return to query results.
Submit another query.