DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and UNE5

DIOPT Version :9

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_182269.1 Gene:UNE5 / 819360 AraportID:AT2G47470 Length:361 Species:Arabidopsis thaliana


Alignment Length:163 Identity:38/163 - (23%)
Similarity:66/163 - (40%) Gaps:34/163 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YFLFSLLIWSAQSDKSLSKQSGNVTTITNLSVKARSADQCTPGTILKLRVDNF-FETTEDGTFFV 71
            :.|.:||:.||.:|        :|..:|:                     |:| .|..:|....|
plant    10 FALLALLLVSAVAD--------DVVVLTD---------------------DSFEKEVGKDKGALV 45

  Fly    72 KFYEPNCMGCHDFETTWTDMAKSFKSKENICFAELNCKFAKTICNDYELRYEPNLIWLENGE-EV 135
            :||.|.|..|......:..:..|||..:::..|:::|...|::|..|.:...|.:.|...|. |.
plant    46 EFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEP 110

  Fly   136 QQYDGDLTSPGIKIFVWEMIRRNETNKSAAKRP 168
            |:|:|...:..:..:|   .:...||...|..|
plant   111 QKYEGPRNAEALAEYV---NKEGGTNVKLAAVP 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Thioredoxin_like 51..151 CDD:294274 25/101 (25%)
UNE5NP_182269.1 PDI_a_ERp38 28..126 CDD:239296 26/118 (22%)
PDI_a_ERp38 142..245 CDD:239296
ERp29c 266..357 CDD:238146
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000934
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.