DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and Pdia5

DIOPT Version :10

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_082571.1 Gene:Pdia5 / 72599 MGIID:1919849 Length:517 Species:Mus musculus


Alignment Length:120 Identity:31/120 - (25%)
Similarity:52/120 - (43%) Gaps:4/120 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TILKLRVDNFFETTEDGTF-FVKFYEPNCMGCHDFETTWTDMAKSFKSKENICFAELNCKFAKT- 113
            ::|.|..|||.:|.:.... .|.||.|.|..|......:|..|.:||....|..|.::|...|. 
Mouse   396 SVLHLVGDNFRDTLKKKKHTLVMFYAPWCPHCKKVIPHFTATADAFKEDRKIACAAVDCVKDKNQ 460

  Fly   114 -ICNDYELRYEPNLIWLENGEEVQQYDGDLTSPGIKIFVWEMIRRNETNKSAAKR 167
             :|....::..|...:...|:.|::|:.|.|..|...|: ..:|..:..:...:|
Mouse   461 DLCQQEAVKAYPTFHYYHYGKLVEKYESDRTELGFTSFI-RTLREGDLKRLEKRR 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 51..151 CDD:469754 28/102 (27%)
Pdia5NP_082571.1 PDI_b_PDIR_N 26..137 CDD:239365
PDI_a_PDIR 150..254 CDD:239295
PDI_a_PDIR 275..377 CDD:239295
PDI_a_PDIR 396..499 CDD:239295 28/102 (27%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 514..517 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.