DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and Pdia6

DIOPT Version :9

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_082235.2 Gene:Pdia6 / 71853 MGIID:1919103 Length:440 Species:Mus musculus


Alignment Length:161 Identity:37/161 - (22%)
Similarity:65/161 - (40%) Gaps:27/161 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LSKQSGNVTTITNLSVKARSADQCTPGTILKLRVDNFFETTEDG--TFFVKFYEPNCMGCHDFET 86
            |..:||..:     |.|....|..:...:::|..|.|.:...|.  .:.|:||.|.|..|.:.|.
Mouse   139 LGGRSGGYS-----SGKQGRGDSSSKKDVVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEP 198

  Fly    87 TWTDMAKSFK--SKENICFAELNCKFAKTICNDYELRYEPNLIWLENGEEVQQYDG-----DLTS 144
            .|...|...|  :|..:..|.::....:.:.:.|.::..|.:...:.||....|||     |:.|
Mouse   199 EWAAAATEVKEQTKGKVKLAAVDATMNQVLASRYGIKGFPTIKIFQKGESPVDYDGGRTRSDIVS 263

  Fly   145 PGIKIF--------VWEMIRRNETNKSAAKR 167
            ..:.:|        :.|:|     |:..||:
Mouse   264 RALDLFSDNAPPPELLEII-----NEDIAKK 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Thioredoxin_like 51..151 CDD:294274 26/116 (22%)
Pdia6NP_082235.2 PDI_a_P5 26..128 CDD:239299
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..161 6/26 (23%)
PDI_a_P5 161..266 CDD:239299 25/104 (24%)
P5_C 275..404 CDD:239281 5/20 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..440
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 437..440
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000934
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.