DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and Txndc16

DIOPT Version :9

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001297463.1 Gene:Txndc16 / 70561 MGIID:1917811 Length:820 Species:Mus musculus


Alignment Length:99 Identity:22/99 - (22%)
Similarity:36/99 - (36%) Gaps:0/99 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LKLRVDNFFETTEDGTFFVKFYEPNCMGCHDFETTWTDMAKSFKSKENICFAELNCKFAKTICND 117
            ::|..:.|..|.......|.||.........|..::.|:|...|.:..|....:||.....||..
Mouse   395 VELTEETFNTTVMTSDSIVLFYATWHAVSMAFLQSYIDVAIKLKGRSTILLTRINCADWSDICTK 459

  Fly   118 YELRYEPNLIWLENGEEVQQYDGDLTSPGIKIFV 151
            ..:...|.:...:.||....|.|.|.:..:..|:
Mouse   460 QNVTAFPVVKLYKEGESPVSYAGMLATKDLLKFI 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Thioredoxin_like 51..151 CDD:294274 21/97 (22%)
Txndc16NP_001297463.1 ER_PDI_fam 65..493 CDD:273457 21/97 (22%)
PDI_a_family 395..493 CDD:239259 21/97 (22%)
Thioredoxin_6 534..722 CDD:372755
Mediates endoplasmic reticulum retention. /evidence=ECO:0000250|UniProtKB:Q9P2K2 817..820
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.