DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and Dnajc10

DIOPT Version :9

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_077143.2 Gene:Dnajc10 / 66861 MGIID:1914111 Length:793 Species:Mus musculus


Alignment Length:113 Identity:31/113 - (27%)
Similarity:46/113 - (40%) Gaps:3/113 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ILKLRVDNFFETTEDG-TFFVKFYEPNCMGCHDFETTWTDMAKSFKSKENICFAELNCKFAKTIC 115
            |:.|....|......| .:||.||.|.|..|||...||.:.||.......|  ..:||...:.:|
Mouse   131 IITLERREFDAAVNSGELWFVNFYSPGCSHCHDLAPTWREFAKEVDGLLRI--GAVNCGDDRMLC 193

  Fly   116 NDYELRYEPNLIWLENGEEVQQYDGDLTSPGIKIFVWEMIRRNETNKS 163
            ....:...|:|....:|....:|:||.:...:..|..:.:|...|..|
Mouse   194 RMKGVNSYPSLFIFRSGMAAVKYNGDRSKESLVAFAMQHVRSTVTELS 241

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Thioredoxin_like 51..151 CDD:294274 27/99 (27%)