DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and tmx3a

DIOPT Version :9

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001018393.2 Gene:tmx3a / 553578 ZFINID:ZDB-GENE-050522-396 Length:437 Species:Danio rerio


Alignment Length:153 Identity:39/153 - (25%)
Similarity:59/153 - (38%) Gaps:41/153 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DNFFETTEDGTFFVKFYEPNCMGCHDFETTWTDMA---KSFKSKENICFAELNCKFAKTICNDYE 119
            |.|.|..::..:.|:||.|.|..||.||..||::.   ||..|..|:  .:::.....:|..::.
Zfish    28 DKFTEFRQNELWLVEFYAPWCAYCHTFEPVWTEVGAELKSLGSPVNV--GKIDTTAHTSIATEFN 90

  Fly   120 LRYEPNLIWLENGEEVQQYDGDLTSPGI-----------------------------KIFVW--- 152
            :|..|. |.|..|:....|.|..|..||                             .|||:   
Zfish    91 IRGYPT-IKLFKGDLSFDYKGPRTKDGIIEFTNRVSGPVVRPLSSVQLFQHVMSRHDVIFVYIGG 154

  Fly   153 EMIRRNETNKSAAK---RPYFHT 172
            |.:.:.|..|:|.:   ..||.|
Zfish   155 ESLLKKEYYKAATEFIVHTYFFT 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Thioredoxin_like 51..151 CDD:294274 30/124 (24%)
tmx3aNP_001018393.2 PDI_a_TMX3 22..125 CDD:239298 29/99 (29%)
Thioredoxin_6 155..332 CDD:290560 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.