DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and dnajc10

DIOPT Version :9

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_004917970.1 Gene:dnajc10 / 549679 XenbaseID:XB-GENE-980994 Length:792 Species:Xenopus tropicalis


Alignment Length:73 Identity:20/73 - (27%)
Similarity:30/73 - (41%) Gaps:2/73 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 FFVKFYEPNCMGCHDFETTWTDMAKSFKSKENICFAELNCKFAKTICNDYELRYEPNLIWLENGE 133
            :|:.||.|.|..||....||...||.......|  ..:||...:.:|....:...|:|...:.|.
 Frog   149 WFINFYSPGCSHCHTLAPTWRKFAKEMDGLLRI--GAVNCGDNRGLCRSQGINGYPSLCIYKAGM 211

  Fly   134 EVQQYDGD 141
            ...:|.|:
 Frog   212 NPVKYHGE 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Thioredoxin_like 51..151 CDD:294274 20/73 (27%)
dnajc10XP_004917970.1 DnaJ 34..>127 CDD:223560
PDI_a_ERdj5_N 129..229 CDD:239301 20/73 (27%)
ER_PDI_fam 130..551 CDD:273457 20/73 (27%)
PDI_a_ERdj5_C 453..550 CDD:239302
PDI_a_ERdj5_C 556..661 CDD:239302
PDI_a_ERdj5_C 667..773 CDD:239302
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D522268at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.