powered by:
Protein Alignment CG18132 and dnajc10
DIOPT Version :9
Sequence 1: | NP_608603.1 |
Gene: | CG18132 / 33333 |
FlyBaseID: | FBgn0031345 |
Length: | 192 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_004917970.1 |
Gene: | dnajc10 / 549679 |
XenbaseID: | XB-GENE-980994 |
Length: | 792 |
Species: | Xenopus tropicalis |
Alignment Length: | 73 |
Identity: | 20/73 - (27%) |
Similarity: | 30/73 - (41%) |
Gaps: | 2/73 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 69 FFVKFYEPNCMGCHDFETTWTDMAKSFKSKENICFAELNCKFAKTICNDYELRYEPNLIWLENGE 133
:|:.||.|.|..||....||...||.......| ..:||...:.:|....:...|:|...:.|.
Frog 149 WFINFYSPGCSHCHTLAPTWRKFAKEMDGLLRI--GAVNCGDNRGLCRSQGINGYPSLCIYKAGM 211
Fly 134 EVQQYDGD 141
...:|.|:
Frog 212 NPVKYHGE 219
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D522268at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.