DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and DNAJC10

DIOPT Version :9

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_061854.1 Gene:DNAJC10 / 54431 HGNCID:24637 Length:793 Species:Homo sapiens


Alignment Length:110 Identity:31/110 - (28%)
Similarity:44/110 - (40%) Gaps:3/110 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ILKLRVDNFFETTEDG-TFFVKFYEPNCMGCHDFETTWTDMAKSFKSKENICFAELNCKFAKTIC 115
            |:.|....|......| .:||.||.|.|..|||...||.|.||.......|  ..:||...:.:|
Human   131 IITLERREFDAAVNSGELWFVNFYSPGCSHCHDLAPTWRDFAKEVDGLLRI--GAVNCGDDRMLC 193

  Fly   116 NDYELRYEPNLIWLENGEEVQQYDGDLTSPGIKIFVWEMIRRNET 160
            ....:...|:|....:|....:|.||.:...:..|..:.:|...|
Human   194 RMKGVNSYPSLFIFRSGMAPVKYHGDRSKESLVSFAMQHVRSTVT 238

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Thioredoxin_like 51..151 CDD:294274 28/99 (28%)