DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and DNAJC10

DIOPT Version :10

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_061854.1 Gene:DNAJC10 / 54431 HGNCID:24637 Length:793 Species:Homo sapiens


Alignment Length:110 Identity:31/110 - (28%)
Similarity:44/110 - (40%) Gaps:3/110 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ILKLRVDNFFETTEDG-TFFVKFYEPNCMGCHDFETTWTDMAKSFKSKENICFAELNCKFAKTIC 115
            |:.|....|......| .:||.||.|.|..|||...||.|.||.......|  ..:||...:.:|
Human   131 IITLERREFDAAVNSGELWFVNFYSPGCSHCHDLAPTWRDFAKEVDGLLRI--GAVNCGDDRMLC 193

  Fly   116 NDYELRYEPNLIWLENGEEVQQYDGDLTSPGIKIFVWEMIRRNET 160
            ....:...|:|....:|....:|.||.:...:..|..:.:|...|
Human   194 RMKGVNSYPSLFIFRSGMAPVKYHGDRSKESLVSFAMQHVRSTVT 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 51..151 CDD:469754 28/99 (28%)
DNAJC10NP_061854.1 DnaJ 35..157 CDD:440252 8/25 (32%)
PDI_a_ERdj5_N 129..229 CDD:239301 28/99 (28%)
Trxb 1 235..350 1/4 (25%)
Trxb 2 348..463
PDI_a_ERdj5_C 453..550 CDD:239302
PDI_a_ERdj5_C 556..663 CDD:239302
PDI_a_ERdj5_C 670..775 CDD:239302
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 790..793
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.