DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and pdia6

DIOPT Version :10

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001007974.1 Gene:pdia6 / 493341 XenbaseID:XB-GENE-974680 Length:441 Species:Xenopus tropicalis


Alignment Length:100 Identity:28/100 - (28%)
Similarity:46/100 - (46%) Gaps:4/100 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ILKLRVDNFFET--TEDGTFFVKFYEPNCMGCHDFETTWTDMAKSFKSKEN--ICFAELNCKFAK 112
            ::.|..|.|.:.  ..|..:||:||.|.|..|.:.|..|...|...|.:.|  :..|.::...::
 Frog   163 VIDLTDDTFDKNVLNSDDVWFVEFYAPWCGHCKNLEPEWAAAATEIKQQTNGKVKLAAVDATVSQ 227

  Fly   113 TICNDYELRYEPNLIWLENGEEVQQYDGDLTSPGI 147
            .:.:.|.:|..|.:...:.||:...|||..|.|.|
 Frog   228 VLASRYGIRGFPTIKIFQKGEDPVDYDGGRTKPDI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 51..151 CDD:469754 27/99 (27%)
pdia6NP_001007974.1 PDI_a_P5 26..128 CDD:239299
PDI_a_P5 162..267 CDD:239299 27/99 (27%)
P5_C 276..405 CDD:239281
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.