DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and l(2)01289

DIOPT Version :9

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001163065.1 Gene:l(2)01289 / 46017 FlyBaseID:FBgn0010482 Length:1786 Species:Drosophila melanogaster


Alignment Length:118 Identity:29/118 - (24%)
Similarity:48/118 - (40%) Gaps:26/118 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 VKFYEPNCMGCHDFETTWTDMAKSFKSKENI--CFAELNCKFAKTICNDYELRYE------PNLI 127
            |.||:..|..|.|.          .:..|||  ...:...:|.|:  ||.:|.:|      |.|:
  Fly   935 VFFYDDECESCSDI----------LEELENIDDDTDKHGIQFVKS--NDVKLAHEIGIFAFPALV 987

  Fly   128 WLENGEEVQQYDGDLTSPGIKIFVWEMIRRNETNKSAAKR----PYFHTKPII 176
            :.|.|..: .|||::.| ...:|.|.:.::.:.:.....|    .|..||..:
  Fly   988 YYETGVPI-MYDGNIAS-NQDVFNWILEQKADQSIQLINRDQLFEYIGTKDFL 1038

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Thioredoxin_like 51..151 CDD:294274 23/87 (26%)
l(2)01289NP_001163065.1 PDI_a_family 50..145 CDD:239259
PDI_a_family 384..479 CDD:239259
Thioredoxin_6 510..689 CDD:404691
ER_PDI_fam 700..>916 CDD:273457
PDI_a_family 1129..1226 CDD:239259
TRX_family 1433..>1502 CDD:239245
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.