DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and CG11790

DIOPT Version :10

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_651326.1 Gene:CG11790 / 42999 FlyBaseID:FBgn0039265 Length:302 Species:Drosophila melanogaster


Alignment Length:170 Identity:38/170 - (22%)
Similarity:58/170 - (34%) Gaps:50/170 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 DQCTPGTILKLRVDNFFETTE------DGTFFVKFYEPNCMGCHDFETTWTDMAKSFKSKENICF 103
            |...| .:.:|..|||...|:      .|.:|:.|....|..|......|..:....|.|.||  
  Fly   120 DNLEP-AVKELSDDNFEHLTQASSGATTGDWFIFFSSAECTVCQRLYAVWESVGGKLKRKLNI-- 181

  Fly   104 AELNCKFAKTICNDYELRYEPNLIWLENGEEVQQYDGDLTSPGIKIFVWEMIRRNETNKSAAKR- 167
            |.:|.                    ||:|.......|.|.:|.   |::  :|:.:..|.:||: 
  Fly   182 ARMNS--------------------LESGISTATRLGVLEAPA---FIF--LRQGKMYKYSAKQY 221

  Fly   168 -------------PYFHTKPI--ILFGWFLYAGDVISYFA 192
                         ...|.:|:  |......:.|.:.||||
  Fly   222 SPEAFVQFAEKGYTQSHPQPVPAIPSAVNEFLGPLQSYFA 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 51..151 CDD:469754 23/105 (22%)
CG11790NP_651326.1 PTZ00102 27..>174 CDD:240266 13/54 (24%)
PTZ00443 125..302 CDD:185622 36/164 (22%)

Return to query results.
Submit another query.