DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and CG14695

DIOPT Version :10

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster


Alignment Length:43 Identity:12/43 - (27%)
Similarity:17/43 - (39%) Gaps:8/43 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 ADQCTPGTILKLRVD------NFFETTEDGT--FFVKFYEPNC 78
            |||.....:|.....      |:||..|:.:  ..|..|:|.|
  Fly   137 ADQLFRAVVLGATASLDSKPMNYFELREESSSDMLVMLYDPAC 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 51..151 CDD:469754 9/36 (25%)
CG14695NP_650032.1 None

Return to query results.
Submit another query.