DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and txndc5

DIOPT Version :9

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_005162560.1 Gene:txndc5 / 406289 ZFINID:ZDB-GENE-040426-1951 Length:403 Species:Danio rerio


Alignment Length:124 Identity:36/124 - (29%)
Similarity:62/124 - (50%) Gaps:1/124 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ILKLRVDNFFETTEDGTFFVKFYEPNCMGCHDFETTWTDMAKSFKSKENICFAELNCKFAKTICN 116
            :.:|...||......|:.||||:.|.|..|.....||..:|.||:..::|..::::|.....:|:
Zfish   160 LYELTATNFKSHIAKGSHFVKFFAPWCGHCKAMAPTWEQLASSFEHSDSIKISKVDCTQHYEVCS 224

  Fly   117 DYELRYEPNLIWLENGEEVQQYDGDLTSPGIKIFVWEMIRRNETNKSAAKRPYFHTKPI 175
            |.::|..|.|::..:||::.||.|.......|.||...::..| :|...::...||..|
Zfish   225 DNQVRGYPTLLFFTDGEKIDQYKGKRDLDSFKEFVDNHVKAAE-SKDEPEKEEEHTHEI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Thioredoxin_like 51..151 CDD:294274 29/98 (30%)
txndc5XP_005162560.1 ER_PDI_fam 33..403 CDD:273457 36/124 (29%)
Thioredoxin_like 34..133 CDD:294274
PDI_a_ERp46 159..259 CDD:239303 29/98 (30%)
PDI_a_ERp46 294..395 CDD:239303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D522268at2759
OrthoFinder 1 1.000 - - FOG0000934
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.