DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and p4hb

DIOPT Version :10

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001034820.1 Gene:p4hb / 395048 XenbaseID:XB-GENE-494070 Length:506 Species:Xenopus tropicalis


Alignment Length:111 Identity:29/111 - (26%)
Similarity:47/111 - (42%) Gaps:21/111 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LKLRVDNFFET---TEDGTFFVKFYEPNCMGCHDFETTWTDMAKSFKSKENICFAELNCKFAKTI 114
            :|:.|...||.   .|:...||:||.|.|..|......|..:.:.:|..|||..|:::     :.
 Frog   369 VKILVGKNFEEVVFNEEKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDHENIIIAKMD-----ST 428

  Fly   115 CNDYE---------LRYEPNLIWLENGEEVQQYDGDLTSPGIKIFV 151
            .|:.|         |::.|    ...|:.|..|:|:.|..|...|:
 Frog   429 ANEIEAVKIHSFPTLKFFP----AGPGKNVADYNGERTLEGFSKFL 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 51..151 CDD:469754 28/109 (26%)
p4hbNP_001034820.1 ER_PDI_fam 25..474 CDD:273457 29/111 (26%)

Return to query results.
Submit another query.