DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and txndc5

DIOPT Version :10

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_989186.1 Gene:txndc5 / 394794 XenbaseID:XB-GENE-490945 Length:405 Species:Xenopus tropicalis


Alignment Length:129 Identity:37/129 - (28%)
Similarity:61/129 - (47%) Gaps:6/129 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ILKLRVDNFFETTEDGTFFVKFYEPNCMGCHDFETTWTDMAKSFKSKENICFAELNCKFAKTICN 116
            :.:|...||.|...:|..|:||:.|.|..|......|..:|.:|:...:|..|:::|.....:|:
 Frog   164 LYELTAANFKEHIAEGNHFIKFFAPWCGHCKALAPAWEQLAATFQDSNSIKIAKVDCTQHNGLCS 228

  Fly   117 DYELRYEPNLIWLENGEEVQQYDGDLTSPGIKIFVWEMI-----RRNETNKSAAKRPYFHTKPI 175
            |.::|..|.|:|..|||:|.||.|......:|.:....:     ::.|..|..|..|... ||:
 Frog   229 DNQVRGYPTLLWFRNGEKVDQYKGKRDLDSLKEYAESQLKPAEEKKEEEQKEDATPPQVE-KPV 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 51..151 CDD:469754 31/98 (32%)
txndc5NP_989186.1 PDI_a_ERp46 36..134 CDD:239303
PDI_a_ERp46 163..262 CDD:239303 31/97 (32%)
PDI_a_ERp46 296..397 CDD:239303
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.