DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and txndc5

DIOPT Version :9

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_989186.1 Gene:txndc5 / 394794 XenbaseID:XB-GENE-490945 Length:405 Species:Xenopus tropicalis


Alignment Length:129 Identity:37/129 - (28%)
Similarity:61/129 - (47%) Gaps:6/129 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ILKLRVDNFFETTEDGTFFVKFYEPNCMGCHDFETTWTDMAKSFKSKENICFAELNCKFAKTICN 116
            :.:|...||.|...:|..|:||:.|.|..|......|..:|.:|:...:|..|:::|.....:|:
 Frog   164 LYELTAANFKEHIAEGNHFIKFFAPWCGHCKALAPAWEQLAATFQDSNSIKIAKVDCTQHNGLCS 228

  Fly   117 DYELRYEPNLIWLENGEEVQQYDGDLTSPGIKIFVWEMI-----RRNETNKSAAKRPYFHTKPI 175
            |.::|..|.|:|..|||:|.||.|......:|.:....:     ::.|..|..|..|... ||:
 Frog   229 DNQVRGYPTLLWFRNGEKVDQYKGKRDLDSLKEYAESQLKPAEEKKEEEQKEDATPPQVE-KPV 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Thioredoxin_like 51..151 CDD:294274 31/98 (32%)
txndc5NP_989186.1 PDI_a_ERp46 36..134 CDD:239303
PDI_a_ERp46 163..262 CDD:239303 31/97 (32%)
PDI_a_ERp46 296..397 CDD:239303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D522268at2759
OrthoFinder 1 1.000 - - FOG0000934
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.