DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and ERp60

DIOPT Version :9

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_725084.2 Gene:ERp60 / 36270 FlyBaseID:FBgn0033663 Length:489 Species:Drosophila melanogaster


Alignment Length:135 Identity:37/135 - (27%)
Similarity:63/135 - (46%) Gaps:5/135 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ILKLRVDNFFET-TEDGTFFVKFYEPNCMGCHDFETTWTDMAKSFKSKE-NICFAELNCKFA-KT 113
            :|:|..|:|..| .:..|..|.||.|.|..|...:..:...|:..|..: .|..|:::|..| |.
  Fly    24 VLELGDDDFATTLKQHETTLVMFYAPWCGHCKRLKPEYAKAAEIVKDDDPPIKLAKVDCTEAGKE 88

  Fly   114 ICNDYELRYEPNLIWLENGEEVQQYDGDLTSPGIKIFVWEMI-RRNETNKSAAK-RPYFHTKPII 176
            .|:.|.:...|.|......|..|.|:|...:.||..::...: ..::|.::.|: :.:..||...
  Fly    89 TCSKYSVSGYPTLKIFRQDEVSQDYNGPREASGIAKYMRAQVGPASKTVRTVAELKKFLDTKDTT 153

  Fly   177 LFGWF 181
            |||:|
  Fly   154 LFGYF 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Thioredoxin_like 51..151 CDD:294274 29/101 (29%)
ERp60NP_725084.2 ER_PDI_fam 23..479 CDD:273457 37/135 (27%)
PDI_a_PDIR 23..126 CDD:239295 29/101 (29%)
PDI_b_ERp57 133..235 CDD:239367 8/26 (31%)
PDI_b'_ERp72_ERp57 239..345 CDD:239371
PDI_a_PDI_a'_C 365..467 CDD:239293
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.