DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and Pdia5

DIOPT Version :9

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001014147.1 Gene:Pdia5 / 360722 RGDID:1359236 Length:517 Species:Rattus norvegicus


Alignment Length:120 Identity:32/120 - (26%)
Similarity:52/120 - (43%) Gaps:4/120 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TILKLRVDNFFETTEDGTF-FVKFYEPNCMGCHDFETTWTDMAKSFKSKENICFAELNCKFAKT- 113
            ::|.|..|||.||.:.... .|.||.|.|..|......:|..|.:||....|..|.::|...|. 
  Rat   396 SVLHLVGDNFRETLKKKKHTLVMFYAPWCPHCKKVIPHFTATADAFKDDRKIACAAVDCVKDKNQ 460

  Fly   114 -ICNDYELRYEPNLIWLENGEEVQQYDGDLTSPGIKIFVWEMIRRNETNKSAAKR 167
             :|....::..|...:...|:.|::|:.|.|..|...|: ..:|..:..:...:|
  Rat   461 DLCQQESVKAYPTFHYYHYGKLVEKYESDRTELGFTSFI-RTLREGDLKRLEKRR 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Thioredoxin_like 51..151 CDD:294274 29/102 (28%)
Pdia5NP_001014147.1 PDI_b_PDIR_N 26..137 CDD:239365
PDI_a_PDIR 150..254 CDD:239295
ER_PDI_fam 166..501 CDD:273457 30/105 (29%)
PDI_a_PDIR 275..377 CDD:239295
PDI_a_PDIR 396..499 CDD:239295 29/102 (28%)
Prevents secretion from ER. /evidence=ECO:0000255 514..517 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D522268at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.