DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and CG9302

DIOPT Version :9

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_609645.2 Gene:CG9302 / 34750 FlyBaseID:FBgn0032514 Length:510 Species:Drosophila melanogaster


Alignment Length:94 Identity:25/94 - (26%)
Similarity:40/94 - (42%) Gaps:1/94 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ILKLRVDNFFETTEDGTF-FVKFYEPNCMGCHDFETTWTDMAKSFKSKENICFAELNCKFAKTIC 115
            :|.|..|||..|.:.... .|.||.|.|..|...:..:|..|.:.:....|.|..::|.....:|
  Fly   398 VLFLDDDNFSSTLKRKKHALVMFYAPWCGHCKHTKPEFTAAATALQDDPRIAFVAIDCTKLAALC 462

  Fly   116 NDYELRYEPNLIWLENGEEVQQYDGDLTS 144
            ..|.:|..|.:::....:....|:|..||
  Fly   463 AKYNVRGYPTILYFSYLKTKLDYNGGRTS 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Thioredoxin_like 51..151 CDD:294274 25/94 (27%)
CG9302NP_609645.2 PDI_b_PDIR_N 24..131 CDD:239365
PDI_a_PDIR 144..249 CDD:239295
ER_PDI_fam 166..500 CDD:273457 25/94 (27%)
PDI_a_PDIR 272..373 CDD:239295
PDI_a_PDIR 397..498 CDD:239295 25/94 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D522268at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.