DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and pdia6

DIOPT Version :10

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_922915.2 Gene:pdia6 / 322160 ZFINID:ZDB-GENE-030131-879 Length:440 Species:Danio rerio


Alignment Length:111 Identity:29/111 - (26%)
Similarity:47/111 - (42%) Gaps:4/111 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ILKLRVDNFFETT--EDGTFFVKFYEPNCMGCHDFETTWTDMAKSFK--SKENICFAELNCKFAK 112
            :::|..|||..|.  .|..:.|:|:.|.|..|.:.|..||..|...|  :|..:..|..:....:
Zfish   162 VVELTDDNFDRTVLESDDVWLVEFFAPWCGHCKNLEPEWTAAATEVKEQTKGKVRLAAEDATVHQ 226

  Fly   113 TICNDYELRYEPNLIWLENGEEVQQYDGDLTSPGIKIFVWEMIRRN 158
            .:.:.:.:|..|.:.....|||.:.|.|..|...|.....|:...|
Zfish   227 GLASRFGIRGFPTIKVFRKGEEPEDYQGGRTRSDIVARALELYSDN 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 51..151 CDD:469754 27/102 (26%)
pdia6NP_922915.2 PDI_a_P5 26..128 CDD:239299
PDI_a_P5 161..266 CDD:239299 27/103 (26%)
P5_C 275..404 CDD:239281
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.