DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and prtp

DIOPT Version :9

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001188583.1 Gene:prtp / 32124 FlyBaseID:FBgn0030329 Length:416 Species:Drosophila melanogaster


Alignment Length:119 Identity:36/119 - (30%)
Similarity:67/119 - (56%) Gaps:4/119 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 VKARSADQCTPGTILKLRVDNFFETTEDGTFFVKFYEPNCMGCHDFETTWTDMAKSFKSKENICF 103
            ||....:....|.::.|..|.|.:....|..||||:.|.|..|.....||.|:||....:..:..
  Fly   155 VKREQVENLNIGKVVDLTEDTFAKHVSTGNHFVKFFAPWCSHCQRLAPTWEDLAKELIKEPTVTI 219

  Fly   104 AELNCKFAKTICNDYELRYEPNLIWLENGEEVQQYDG--DLTSPGIKIFVWEMI 155
            ::::|...::||.|:|::..|.|:|:|:|:::::|.|  ||::  :|.:|.:|:
  Fly   220 SKIDCTQFRSICQDFEVKGYPTLLWIEDGKKIEKYSGARDLST--LKTYVEKMV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Thioredoxin_like 51..151 CDD:294274 31/101 (31%)
prtpNP_001188583.1 PDI_a_ERp46 38..140 CDD:239303
ER_PDI_fam 39..409 CDD:273457 36/119 (30%)
PDI_a_ERp46 167..267 CDD:239303 31/101 (31%)
PDI_a_ERp46 303..407 CDD:239303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2581
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D522268at2759
OrthoFinder 1 1.000 - - FOG0000934
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.