DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and pdi4

DIOPT Version :10

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_594172.4 Gene:pdi4 / 2543474 PomBaseID:SPAC959.05C Length:632 Species:Schizosaccharomyces pombe


Alignment Length:74 Identity:19/74 - (25%)
Similarity:37/74 - (50%) Gaps:4/74 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 FVKFYE-PNCMGCHDFETTWTDMAKSFKSKENICFAELNCKFAKTICNDYELRYEPNLIWLENGE 133
            ||.|.. .:|..|..:|..|:.:.::  :.|.:..|::||...|.:||.:.::..|.....:..:
pombe   200 FVMFVSLKHCEDCFHWEAVWSSITRN--TDERLKMAQVNCDEEKEMCNHFHIKKFPTFRVFQGFD 262

  Fly   134 EVQQYDGDL 142
            .: ||:|.|
pombe   263 SI-QYNGPL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 51..151 CDD:469754 19/74 (26%)
pdi4NP_594172.4 PDI_a_family 183..278 CDD:239259 19/74 (26%)

Return to query results.
Submit another query.